| Tbio | Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform |
The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. The PP2A-PPP2R5C holoenzyme may specifically dephosphorylate and activate TP53 and play a role in DNA damage-induced inhibition of cell proliferation. PP2A-PPP2R5C may also regulate the ERK signaling pathway through ERK dephosphorylation.
The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Chromosomal Instability | 8 | 0.0 | 0.0 |
| Leukemia, Lymphocytic, Chronic, B-Cell | 34 | 0.0 | 0.0 |
| Micronuclei, Chromosome-Defective | 25 | 0.0 | 0.0 |
| Thyroid cancer, papillary | 14 | 0.0 | 0.0 |
| Disease | Target Count |
|---|---|
| Chronic Lymphocytic Leukemia | 262 |
| Disease | Target Count | P-value |
|---|---|---|
| ovarian cancer | 8520 | 7.4e-13 |
| tuberculosis | 2010 | 3.2e-08 |
| Pick disease | 1894 | 1.7e-06 |
| intraductal papillary-mucinous adenoma (IPMA) | 2955 | 2.2e-04 |
| psoriasis | 6694 | 3.8e-04 |
| medulloblastoma, large-cell | 6241 | 8.5e-04 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 1.0e-03 |
| astrocytic glioma | 2597 | 1.8e-03 |
| oligodendroglioma | 2850 | 1.9e-03 |
| ependymoma | 4679 | 5.3e-03 |
| dermatomyositis | 966 | 5.4e-03 |
| interstitial cystitis | 2312 | 8.8e-03 |
| Waldenstrons macroglobulinemia | 765 | 1.4e-02 |
| intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 1.5e-02 |
| osteosarcoma | 7950 | 2.3e-02 |
| gastric carcinoma | 807 | 3.4e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Autistic Disorder | 364 | 0.0 | 1.2 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| EEC syndrome | 8 | 3.552 | 1.8 |
| Disease | log2 FC | p |
|---|---|---|
| astrocytic glioma | 1.300 | 1.8e-03 |
| dermatomyositis | 1.100 | 5.4e-03 |
| ependymoma | 1.300 | 5.3e-03 |
| gastric carcinoma | 1.200 | 3.4e-02 |
| interstitial cystitis | 1.300 | 8.8e-03 |
| intraductal papillary-mucinous adenoma (... | 1.800 | 2.2e-04 |
| intraductal papillary-mucinous carcinoma... | 1.900 | 1.0e-03 |
| intraductal papillary-mucinous neoplasm ... | 1.100 | 1.5e-02 |
| medulloblastoma, large-cell | -1.300 | 8.5e-04 |
| oligodendroglioma | 1.400 | 1.9e-03 |
| osteosarcoma | -1.056 | 2.3e-02 |
| ovarian cancer | -1.700 | 7.4e-13 |
| Pick disease | 1.500 | 1.7e-06 |
| psoriasis | -1.200 | 3.8e-04 |
| tuberculosis | -1.200 | 3.2e-08 |
| Waldenstrons macroglobulinemia | 1.131 | 1.4e-02 |
| Species | Source | Disease |
|---|---|---|
| OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA | ||
| Inparanoid OMA | ||
| Inparanoid OMA |
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKR 1 - 70 AALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEF 71 - 140 FLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYR 141 - 210 FIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDST 211 - 280 LTEPVVMALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYW 281 - 350 NNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK 351 - 420 LKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAHQAQKDPKKDR 421 - 490 PLARRKSELPQDPHTKKALEAHCRADELASQDGR 491 - 524 //
