Tbio | Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform |
The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. The PP2A-PPP2R5C holoenzyme may specifically dephosphorylate and activate TP53 and play a role in DNA damage-induced inhibition of cell proliferation. PP2A-PPP2R5C may also regulate the ERK signaling pathway through ERK dephosphorylation.
The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Chromosomal Instability | 4 |
Micronuclei, Chromosome-Defective | 20 |
chronic lymphocytic leukemia | 244 |
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8492 | 7.41658643047112E-13 |
osteosarcoma | 7933 | 1.2268471732872E-7 |
tuberculosis and treatment for 3 months | 327 | 4.73297799768963E-7 |
Pick disease | 1893 | 1.68480129833613E-6 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 2.223541439196E-4 |
medulloblastoma, large-cell | 6234 | 8.4858941938346E-4 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 0.00101190537299903 |
psoriasis | 6685 | 0.00126169618326933 |
astrocytic glioma | 2241 | 0.00177437560741615 |
oligodendroglioma | 2849 | 0.00185494310442169 |
ependymoma | 2514 | 0.00530406054012309 |
dermatomyositis | 967 | 0.005420189696649 |
interstitial cystitis | 2299 | 0.008759516528519 |
Waldenstrons macroglobulinemia | 765 | 0.014462208706026 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.01469580582485 |
gastric carcinoma | 832 | 0.0340827093452665 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Autistic Disorder | 320 | 0.0 | 1.0 |
Disease | log2 FC | p |
---|---|---|
Waldenstrons macroglobulinemia | 1.131 | 0.014 |
astrocytic glioma | 1.300 | 0.002 |
ependymoma | 1.300 | 0.005 |
oligodendroglioma | 1.400 | 0.002 |
psoriasis | -1.400 | 0.001 |
osteosarcoma | -2.018 | 0.000 |
medulloblastoma, large-cell | -1.300 | 0.001 |
tuberculosis and treatment for 3 months | -1.300 | 0.000 |
intraductal papillary-mucinous adenoma (... | 1.800 | 0.000 |
intraductal papillary-mucinous carcinoma... | 1.900 | 0.001 |
intraductal papillary-mucinous neoplasm ... | 1.100 | 0.015 |
interstitial cystitis | 1.300 | 0.009 |
Pick disease | 1.500 | 0.000 |
gastric carcinoma | 1.200 | 0.034 |
ovarian cancer | -1.700 | 0.000 |
dermatomyositis | 1.100 | 0.005 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA Inparanoid |
C. elegans | OMA Inparanoid |
PMID | Text |
---|---|
26440364 | our data suggest that hepatic PPP2R5C represents an important factor in the functional wiring of energy metabolism and the maintenance of a metabolically healthy state. |
25972378 | Mutations in the PP2A regulatory subunit B family genes PPP2R5B, PPP2R5C and PPP2R5D cause human overgrowth |
25888193 | propose that the mechanism for proliferation inhibition and increased apoptosis of K562 cells following PPP2R5C suppression may be related to the alteration of expression profiles of BRAF, AKT2, AKT3, NFKB2 and STAT3 genes |
25884766 | Differential expression of the transcripts PPP2R5C connects ubiquitin-proteasome system with infection-inflammation in preterm births and preterm premature rupture of membranes. |
25512391 | KIF4A and PP2A-B56G and -B56E create a spatially restricted negative feedback loop counteracting Aurora B in anaphase. |
24719332 | Data indicate that the regulatory PP2A subunit B56gamma mediates suppression of NF-kappaB resulting in increased NF-kappaB target gene expression in T cells. |
23941244 | PPP2R5C-siRNA treatment altered gene expression profiles in malignant T cells |
23723076 | Results show that mutations lost B56gamma tumor-suppressive activity by two distinct mechanisms: one is by disrupting interactions with the PP2A AC core and the other with B56gamma-PP2A substrates (p53 and unknown proteins). |
23287597 | HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells |
22315229 | structural insight into the PP2A holoenzyme assembly and emphasizes the importance of HEAT repeat 1 in B56gamma-PP2A tumor-suppressive function |
More... |
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKR 1 - 70 AALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEF 71 - 140 FLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYR 141 - 210 FIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDST 211 - 280 LTEPVVMALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYW 281 - 350 NNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK 351 - 420 LKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAHQAQKDPKKDR 421 - 490 PLARRKSELPQDPHTKKALEAHCRADELASQDGR 491 - 524 //
PMID | Year | Title |
---|---|---|
27173435 | 2016 | An organelle-specific protein landscape identifies novel diseases and molecular mechanisms. |
26440364 | 2015 | PPP2R5C Couples Hepatic Glucose and Lipid Homeostasis. |
25972378 | 2015 | Mutations in the PP2A regulatory subunit B family genes PPP2R5B, PPP2R5C and PPP2R5D cause human overgrowth. |
25888193 | 2015 | Alteration of gene expression profile following PPP2R5C knockdown may be associated with proliferation suppression and increased apoptosis of K562 cells. |
25884766 | 2015 | Epigenetic regulation of lncRNA connects ubiquitin-proteasome system with infection-inflammation in preterm births and preterm premature rupture of membranes. |
25512391 | 2014 | KIF4A and PP2A-B56 form a spatially restricted feedback loop opposing Aurora B at the anaphase central spindle. |
25241761 | 2014 | Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network. |
24719332 | 2014 | The protein phosphatase 2A regulatory subunit B56? mediates suppression of T cell receptor (TCR)-induced nuclear factor-?B (NF-?B) activity. |
23941244 | 2013 | Differential gene expression profiles of PPP2R5C-siRNA-treated malignant T cells. |
23723076 | 2013 | B56? tumor-associated mutations provide new mechanisms for B56?-PP2A tumor suppressor activity. |
More... |