Property Summary

NCBI Gene PubMed Count 53
PubMed Score 9.09
PubTator Score 6.45

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13362 B4DYJ8 B5BUA5 F5GWP3 Q14391 Q15060 Q15174 Q6ZN33
Symbols B56G
PR61G

Gene

PDB

3FGA   5JJA   2IAE   2JAK   2NPP   2NYL   2NYM  

 GWAS Trait (1)

Gene RIF (32)

PMID Text
26440364 our data suggest that hepatic PPP2R5C represents an important factor in the functional wiring of energy metabolism and the maintenance of a metabolically healthy state.
25972378 Mutations in the PP2A regulatory subunit B family genes PPP2R5B, PPP2R5C and PPP2R5D cause human overgrowth
25888193 propose that the mechanism for proliferation inhibition and increased apoptosis of K562 cells following PPP2R5C suppression may be related to the alteration of expression profiles of BRAF, AKT2, AKT3, NFKB2 and STAT3 genes
25884766 Differential expression of the transcripts PPP2R5C connects ubiquitin-proteasome system with infection-inflammation in preterm births and preterm premature rupture of membranes.
25512391 KIF4A and PP2A-B56G and -B56E create a spatially restricted negative feedback loop counteracting Aurora B in anaphase.
24719332 Data indicate that the regulatory PP2A subunit B56gamma mediates suppression of NF-kappaB resulting in increased NF-kappaB target gene expression in T cells.
23941244 PPP2R5C-siRNA treatment altered gene expression profiles in malignant T cells
23723076 Results show that mutations lost B56gamma tumor-suppressive activity by two distinct mechanisms: one is by disrupting interactions with the PP2A AC core and the other with B56gamma-PP2A substrates (p53 and unknown proteins).
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
22315229 structural insight into the PP2A holoenzyme assembly and emphasizes the importance of HEAT repeat 1 in B56gamma-PP2A tumor-suppressive function
More...

AA Sequence

MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKR      1 - 70
AALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEF     71 - 140
FLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYR    141 - 210
FIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDST    211 - 280
LTEPVVMALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYW    281 - 350
NNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK    351 - 420
LKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAHQAQKDPKKDR    421 - 490
PLARRKSELPQDPHTKKALEAHCRADELASQDGR                                        491 - 524
//

Text Mined References (61)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26440364 2015 PPP2R5C Couples Hepatic Glucose and Lipid Homeostasis.
25972378 2015 Mutations in the PP2A regulatory subunit B family genes PPP2R5B, PPP2R5C and PPP2R5D cause human overgrowth.
25888193 2015 Alteration of gene expression profile following PPP2R5C knockdown may be associated with proliferation suppression and increased apoptosis of K562 cells.
25884766 2015 Epigenetic regulation of lncRNA connects ubiquitin-proteasome system with infection-inflammation in preterm births and preterm premature rupture of membranes.
25512391 2014 KIF4A and PP2A-B56 form a spatially restricted feedback loop opposing Aurora B at the anaphase central spindle.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24719332 2014 The protein phosphatase 2A regulatory subunit B56? mediates suppression of T cell receptor (TCR)-induced nuclear factor-?B (NF-?B) activity.
23941244 2013 Differential gene expression profiles of PPP2R5C-siRNA-treated malignant T cells.
23723076 2013 B56? tumor-associated mutations provide new mechanisms for B56?-PP2A tumor suppressor activity.
More...