Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.89
PubTator Score 11.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.300 3.1e-02
intraductal papillary-mucinous adenoma (... 1.700 2.7e-03
intraductal papillary-mucinous carcinoma... 1.400 5.2e-03
medulloblastoma, large-cell 1.600 4.4e-05
oligodendroglioma 1.200 4.4e-02
osteosarcoma -1.107 1.8e-06

Gene RIF (3)

AA Sequence

MGKRQHQKDKMYITCAEYTHFYGGKKPDLPQTNFRRLPFDHCSLSLQPFVYPVCTPDGIVFDLLNIVPWL      1 - 70
KKYGTNPSNGEKLDGRSLIKLNFSKNSEGKYHCPVLFTVFTNNTHIVAVRTTGNVYAYEAVEQLNIKAKN     71 - 140
FRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFYHVKNNMKIIDPDEEKAKQDPSYYLKNTNAETRETLQE    141 - 210
LYKEFKGDEILAATMKAPEKKKVDKLNAAHYSTGKVSASFTSTAMVPETTHEAAAIDEDVLRYQFVKKKG    211 - 280
YVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPF    281 - 350
KDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTD    351 - 420
RPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAPETKVKSSQPQAGSQGPQTFRQGVGKYINPAATK    421 - 490
RAAEEEPSTSATVPMSKKKPSRGFGDFSSW                                            491 - 520
//

Text Mined References (20)

PMID Year Title