Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.57
PubTator Score 11.76

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13356 Q13357 Q8TAH2 Q9BWR8 PPIase
Symbols CYC4
CYP60
UBOX7
Cyp-60
hCyP-60

Gene

PANTHER Protein Class (1)

PDB

1ZKC  

Gene RIF (3)

PMID Text
19669607 common genetic variation in the BACE1-interacting proteins, RTN3 an PPIL2, does not influence platelet b-secretase activity or susceptibility to Alzheimer's disease in this population.
19669607 Observational study of gene-disease association. (HuGE Navigator)
15946952 cyclophilin 60 regulates cell surface expression of CD147/EMMPRIN

AA Sequence

MGKRQHQKDKMYITCAEYTHFYGGKKPDLPQTNFRRLPFDHCSLSLQPFVYPVCTPDGIVFDLLNIVPWL      1 - 70
KKYGTNPSNGEKLDGRSLIKLNFSKNSEGKYHCPVLFTVFTNNTHIVAVRTTGNVYAYEAVEQLNIKAKN     71 - 140
FRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFYHVKNNMKIIDPDEEKAKQDPSYYLKNTNAETRETLQE    141 - 210
LYKEFKGDEILAATMKAPEKKKVDKLNAAHYSTGKVSASFTSTAMVPETTHEAAAIDEDVLRYQFVKKKG    211 - 280
YVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPF    281 - 350
KDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTD    351 - 420
RPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAPETKVKSSQPQAGSQGPQTFRQGVGKYINPAATK    421 - 490
RAAEEEPSTSATVPMSKKKPSRGFGDFSSW                                            491 - 520
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
19669607 2009 Variation in RTN3 and PPIL2 genes does not influence platelet membrane beta-secretase activity or susceptibility to alzheimer's disease in the northern Irish population.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15946952 2005 Cell surface expression of CD147/EMMPRIN is regulated by cyclophilin 60.
More...