Property Summary

NCBI Gene PubMed Count 28
Grant Count 6
R01 Count 5
Funding $391,782.9
PubMed Score 14.77
PubTator Score 17.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.632 0.003
Multiple myeloma 1.462 0.003
glioblastoma multiforme 1.300 0.000
osteosarcoma -1.326 0.009
group 3 medulloblastoma 1.700 0.000
medulloblastoma, large-cell 1.200 0.001
lung cancer 1.400 0.000
pituitary cancer 1.100 0.000

Gene RIF (8)

PMID Text
24386901 The beta3-endonexin can act as a novel anti-angiogenic factor specifically in the response to hypoxia due to its negative impact on the activation of HIF-1.
23028590 Data propose that CENP-P/O/R/Q/U self-assembles on kinetochores with varying stoichiometry and undergoes a pre-mitotic maturation step that could be important for kinetochores switching into the correct conformation for microtubule-attachment.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18521086 findings suggest that NRIF3-Ser28 is a physiologic target of Pak1 signaling and contributes to the enhanced NRIF3 co-activator activity, leading to coordinated potentiation of ERalpha transactivation
15254226 Metastasis-associated protein 1 interacts with NRIF3, an estrogen-inducible nuclear receptor coregulator
15082778 Results suggest that breast cancer cells contain a novel "death switch" that can be specifically triggered by NRIF3 or death domain 1.
12244126 This protein downregulates urokinase-type plasminogen activator receptor promoter activity.
11864709 The presence of various isoforms and the relationship between subcellular localization and integrin-activating function of beta(3)-endonexin is described.

AA Sequence

MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHP      1 - 70
SLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK     71 - 140
ELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN                                     141 - 177
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24386901 2014 The ?3-integrin binding protein ?3-endonexin is a novel negative regulator of hypoxia-inducible factor-1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028590 2012 Step-wise assembly, maturation and dynamic behavior of the human CENP-P/O/R/Q/U kinetochore sub-complex.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18521086 2008 Serine 28 phosphorylation of NRIF3 confers its co-activator function for estrogen receptor-alpha transactivation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...