Property Summary

NCBI Gene PubMed Count 28
PubMed Score 15.46
PubTator Score 17.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Endometriosis 540 0.0 0.0
Disease Target Count Z-score Confidence
Omphalocele 24 3.42 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma 1.300 2.5e-02
group 3 medulloblastoma 1.700 8.5e-05
lung cancer 1.300 1.6e-02
medulloblastoma, large-cell 1.200 5.9e-04
Multiple myeloma 1.462 3.5e-03
osteosarcoma -1.326 9.2e-03
pituitary cancer 1.100 2.9e-04
Waldenstrons macroglobulinemia 1.632 2.6e-03

Protein-protein Interaction (2)

Gene RIF (8)

AA Sequence

MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHP      1 - 70
SLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK     71 - 140
ELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN                                     141 - 177
//

Text Mined References (33)

PMID Year Title