Property Summary

NCBI Gene PubMed Count 16
Grant Count 15
R01 Count 15
Funding $1,567,437.17
PubMed Score 29.04
PubTator Score 17.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.292 0.000

Gene RIF (6)

PMID Text
25415295 alpha(D)beta(2) is a major member of the integrin repertoire of both circulating and tissue myeloid leukocytes in humans
23414334 The effects of anti-CD11d treatment improves functional recovery in a rat model of repeated concussion.
21712539 the cross-talk between neutrophils and NK cells is mediated by ICAM-3 and CD11d/CD18, respectively.
21508205 CD11d expression increased in the subcutaneous white adipose tissue of obese adult women; this appears to be a common feature of obesity.
19571252 multiple CD11d domains play a role in controlling intracellular location and association with CD18.
15561714 a longer isoform of gut-enriched Kruppel-like factor 4 (GKLF) we term GKLFa interacts with the CD11d promoter

AA Sequence

MTFGTVLLLSVLASYHGFNLDVEEPTIFQEDAGGFGQSVVQFGGSRLVVGAPLEVVAANQTGRLYDCAAA      1 - 70
TGMCQPIPLHIRPEAVNMSLGLTLAASTNGSRLLACGPTLHRVCGENSYSKGSCLLLGSRWEIIQTVPDA     71 - 140
TPECPHQEMDIVFLIDGSGSIDQNDFNQMKGFVQAVMGQFEGTDTLFALMQYSNLLKIHFTFTQFRTSPS    141 - 210
QQSLVDPIVQLKGLTFTATGILTVVTQLFHHKNGARKSAKKILIVITDGQKYKDPLEYSDVIPQAEKAGI    211 - 280
IRYAIGVGHAFQGPTARQELNTISSAPPQDHVFKVDNFAALGSIQKQLQEKIYAVEGTQSRASSSFQHEM    281 - 350
SQEGFSTALTMDGLFLGAVGSFSWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQNLV    351 - 420
LGAPRYQHTGKAVIFTQVSRQWRKKAEVTGTQIGSYFGASLCSVDVDSDGSTDLILIGAPHYYEQTRGGQ    421 - 490
VSVCPLPRGRVQWQCDAVLRGEQGHPWGRFGAALTVLGDVNEDKLIDVAIGAPGEQENRGAVYLFHGASE    491 - 560
SGISPSHSQRIASSQLSPRLQYFGQALSGGQDLTQDGLMDLAVGARGQVLLLRSLPVLKVGVAMRFSPVE    561 - 630
VAKAVYRCWEEKPSALEAGDATVCLTIQKSSLDQLGDIQSSVRFDLALDPGRLTSRAIFNETKNPTLTRR    631 - 700
KTLGLGIHCETLKLLLPDCVEDVVSPIILHLNFSLVREPIPSPQNLRPVLAVGSQDLFTASLPFEKNCGQ    701 - 770
DGLCEGDLGVTLSFSGLQTLTVGSSLELNVIVTVWNAGEDSYGTVVSLYYPAGLSHRRVSGAQKQPHQSA    771 - 840
LRLACETVPTEDEGLRSSRCSVNHPIFHEGSNGTFIVTFDVSYKATLGDRMLMRASASSENNKASSSKAT    841 - 910
FQLELPVKYAVYTMISRQEESTKYFNFATSDEKKMKEAEHRYRVNNLSQRDLAISINFWVPVLLNGVAVW    911 - 980
DVVMEAPSQSLPCVSERKPPQHSDFLTQISRSPMLDCSIADCLQFRCDVPSFSVQEELDFTLKGNLSFGW    981 - 1050
VRETLQKKVLVVSVAEITFDTSVYSQLPGQEAFMRAQMEMVLEEDEVYNAIPIIMGSSVGALLLLALITA   1051 - 1120
TLYKLGFFKRHYKEMLEDKPEDTATFSGDDFSCVAPNVPLS                                1121 - 1161
//

Text Mined References (16)

PMID Year Title
25415295 2014 Integrin ?D?2 (CD11d/CD18) is expressed by human circulating and tissue myeloid leukocytes and mediates inflammatory signaling.
23414334 2013 Treatment with an anti-CD11d integrin antibody reduces neuroinflammation and improves outcome in a rat model of repeated concussion.
21712539 2011 On the potential involvement of CD11d in co-stimulating the production of interferon-? by natural killer cells upon interaction with neutrophils via intercellular adhesion molecule-3.
21508205 2011 Inflammatory phenotyping identifies CD11d as a gene markedly induced in white adipose tissue in obese rodents and women.
20563599 2010 Integrin expression and integrin-mediated adhesion in vitro of human multipotent stromal cells (MSCs) to endothelial cells from various blood vessels.
20187620 2010 Optical and conformational studies on benzobisthiazole derivatives.
19571252 2009 The extracellular domain of CD11d regulates its cell surface expression.
15561714 2005 The leukocyte integrin gene CD11d is repressed by gut-enriched Kruppel-like factor 4 in myeloid cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12429998 2002 Expression of the myeloid-specific leukocyte integrin gene CD11d during macrophage foam cell differentiation and exposure to lipoproteins.
More...