Property Summary

NCBI Gene PubMed Count 18
PubMed Score 14.16
PubTator Score 10.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 1.100 4.0e-02
cutaneous lupus erythematosus 2.700 5.7e-04
interstitial cystitis 2.400 6.4e-03
lung cancer -1.300 1.6e-02
lung carcinoma -2.400 5.1e-28
nasopharyngeal carcinoma -1.100 3.1e-02
osteosarcoma -3.581 1.2e-08
primary Sjogren syndrome 2.100 1.2e-03
ulcerative colitis 1.500 3.5e-03

 GO Process (1)

Gene RIF (7)

AA Sequence

MAQQGQQGQMASGDSNLNFRMVAEIQNVEGQNLQEQVCPEPIFRFFRENKVEIASAITRPFPFLMGLRDR      1 - 70
SFISEQMYEHFQEAFRNLVPVTRVMYCVLSELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNVCYEH     71 - 140
SPLQMNNVNDLEDRPRLLPYGKQENSNACHEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPKAGGGDA    141 - 210
EDAPSLLPGGGVSCKLAIQIDEGESEEMPKLLPYDTEVLESNGMIDAARTYSTAPGEKQGEEEGRNSPRK    211 - 280
RNQDKEKYQESPEGRDKETFDLKTPQVTNEGEPEKGLCLLPGEGEEGSDDCSEMCDGEEPQEASSSLARC    281 - 350
GSVSCLSAETFDLKTPQVTNEGEPEKELSLLPGEGEEGSDDCSEMCDGEERQEASSSLARRGSVSSELEN    351 - 420
HPMNEEGESEELASSLLYDNVPGAEQSAYENEKCSCVMCFSEEVPGSPEARTESDQACGTMDTVDIANNS    421 - 490
TLGKPKRKRRKKRGHGWSRMRMRRQENSQQNDNSKADGQVVSSEKKANVNLKDLSKIRGRKRGKPGTRFT    491 - 560
QSDRAAQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQGILVKCIQTEDGKWFTPTEFEI    561 - 630
KGGHARSKNWRLSVRCGGWPLRWLMENGFLPDPPRIRYRKKKRILKSQNNSSVDPCMRNLDECEVCRDGG    631 - 700
ELFCCDTCSRVFHEDCHIPPVEAERTPWNCIFCRMKESPGSQQCCQESEVLERQMCPEEQLKCEFLLLKV    701 - 770
YCCSESSFFAKIPYYYYIREACQGLKEPMWLDKIKKRLNEHGYPQVEGFVQDMRLIFQNHRASYKYKDFG    771 - 840
QMGFRLEAEFEKNFKEVFAIQETNGNN                                               841 - 867
//

Text Mined References (20)

PMID Year Title