Property Summary

NCBI Gene PubMed Count 55
PubMed Score 109.17
PubTator Score 131.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 2.74202007602097E-43
non-small cell lung cancer 2798 6.25711887078319E-11
atypical teratoid/rhabdoid tumor 1095 1.55112941385139E-6
interstitial cystitis 2299 8.63225918634693E-6
cystic fibrosis 1670 1.68493134242913E-5
osteosarcoma 7933 1.72241218137881E-5
tuberculosis 1563 3.37636140234014E-5
colon cancer 1475 1.9072561106243E-4
group 4 medulloblastoma 1875 9.70528430144221E-4
Pick disease 1893 0.00199753533356239
nephrosclerosis 329 0.00212966329927915
pediatric high grade glioma 2712 0.00306004245825271
medulloblastoma, large-cell 6234 0.0044940111697859
glioblastoma 5572 0.00488641581012971
gastric carcinoma 832 0.00933198628967838
astrocytic glioma 2241 0.0118845269611013
Down syndrome 548 0.0120453402791923
pilocytic astrocytoma 3086 0.0129909364025114
cutaneous lupus erythematosus 1056 0.0178496269909236
ovarian cancer 8492 0.0361195955183163
posterior fossa group B ependymoma 1530 0.0418370042479154
subependymal giant cell astrocytoma 2287 0.0455101183700203
primitive neuroectodermal tumor 3031 0.0478297289412823
Disease Target Count Z-score Confidence
Urinary bladder cancer 34 3.052 1.5

Expression

  Differential Expression (23)

Disease log2 FC p
nephrosclerosis 1.131 0.002
gastric carcinoma -1.200 0.009
astrocytic glioma 2.900 0.012
psoriasis -2.400 0.000
cutaneous lupus erythematosus -1.500 0.018
osteosarcoma -5.483 0.000
glioblastoma -2.100 0.005
group 4 medulloblastoma -3.500 0.001
cystic fibrosis 1.839 0.000
atypical teratoid/rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -2.900 0.004
primitive neuroectodermal tumor -2.100 0.048
tuberculosis 1.500 0.000
non-small cell lung cancer -1.693 0.000
colon cancer 5.400 0.000
interstitial cystitis -5.400 0.000
pediatric high grade glioma -2.600 0.003
pilocytic astrocytoma -2.100 0.013
posterior fossa group B ependymoma 1.400 0.042
subependymal giant cell astrocytoma -1.280 0.046
Pick disease 1.800 0.002
ovarian cancer -1.200 0.036
Down syndrome 1.200 0.012

Synonym

Accession Q13336 A8K0P3 B3KR62 B3KVX3 C9EHF2 Q86VM5
Symbols JK
UT1
UTE
HUT11
RACH1
RACH2
UT-B1
HsT1341

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid

 GWAS Trait (1)

Gene RIF (34)

PMID Text
25807964 The Jk(a-b-) phenotype in the Chinese population shows several different molecular mechanisms. A novel missense mutation nt737T>G of JK gene was found as associated with Jk(a-b-) phenotype.
25445116 Reduction or loss of UT-B expression may be related to the incidence, progression and invasiveness of bladder urothelial carcinoma.
25298346 Studies indicate that acid substitution in the urea transporter Slc14A1 UT-B protein determines the erythrocyte Kidd blood group antigen.
25298342 Studies indicate that expression of urea transporter UT-B confers high urea permeability to erythrocytes.
25218484 Results suggested that polymorphism in TERTC/T and SLC14A1C/T confirmed high risk for BC in North Indian population.
25209859 these data confirm the presence of UT-B protein within the human bladder.
24877238 Novel polymorphisms in exon 9 of the JSLC14A1 gene in Japanese individuals associated with the Jk(a-b-) phenotype.
24845979 High-throughput Kell, Kidd, and Duffy matrix-assisted laser desorption/ionization, time-of-flight mass spectrometry-based blood group genotyping of 4000 donors shows close to full concordance with serotyping and detects new alleles.
24376529 UT-B should be considered as a new member of the water channel family.
23898208 HIV-1 Tat downregulates the expression of solute carrier family 14, member 1 (SLC14A1) in human primary T cells
More...

AA Sequence

MEDSPTMVRVDSPTMVRGENQVSPCQGRRCFPKALGYVTGDMKELANQLKDKPVVLQFIDWILRGISQVV      1 - 70
FVNNPVSGILILVGLLVQNPWWALTGWLGTVVSTLMALLLSQDRSLIASGLYGYNATLVGVLMAVFSDKG     71 - 140
DYFWWLLLPVCAMSMTCPIFSSALNSMLSKWDLPVFTLPFNMALSMYLSATGHYNPFFPAKLVIPITTAP    141 - 210
NISWSDLSALELLKSIPVGVGQIYGCDNPWTGGIFLGAILLSSPLMCLHAAIGSLLGIAAGLSLSAPFED    211 - 280
IYFGLWGFNSSLACIAMGGMFMALTWQTHLLALGCALFTAYLGVGMANFMAEVGLPACTWPFCLATLLFL    281 - 350
IMTTKNSNIYKMPLSKVTYPEENRIFYLQAKKRMVESPL                                   351 - 389
//

Text Mined References (59)

PMID Year Title
25807964 2015 A novel missense mutation nt737T>G of JK gene with Jk(a-b-) phenotype in Chinese blood donors.
25445116 2014 Clinical significance of the reduction of UT-B expression in urothelial carcinoma of the bladder.
25298346 2014 Clinical aspects of urea transporters.
25298342 2014 Transport characteristics of urea transporter-B.
25218484 2014 Replicative study of GWAS TP63C/T, TERTC/T, and SLC14A1C/T with susceptibility to bladder cancer in North Indians.
25209859 2014 Expression and localization of a UT-B urea transporter in the human bladder.
24877238 2014 JK null alleles identified from Japanese individuals with Jk(a?b?) phenotype.
24845979 2014 High-throughput Kell, Kidd, and Duffy matrix-assisted laser desorption/ionization, time-of-flight mass spectrometry-based blood group genotyping of 4000 donors shows close to full concordance with serotyping and detects new alleles.
24376529 2013 Energetic and molecular water permeation mechanisms of the human red blood cell urea transporter B.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
More...