Property Summary

Ligand Count 1
NCBI Gene PubMed Count 57
PubMed Score 116.95
PubTator Score 131.92

Knowledge Summary


No data available


  Differential Expression (23)

Disease log2 FC p
astrocytic glioma 2.400 2.9e-02
Astrocytoma, Pilocytic -1.700 2.7e-02
atypical teratoid / rhabdoid tumor -1.900 2.7e-05
colon cancer 5.400 1.9e-04
cutaneous lupus erythematosus -1.500 1.8e-02
cystic fibrosis 1.839 1.7e-05
Down syndrome 1.200 1.2e-02
gastric cancer 1.100 1.6e-03
glioblastoma -1.700 5.8e-03
group 3 medulloblastoma -2.800 1.4e-02
interstitial cystitis -3.300 1.4e-02
medulloblastoma, large-cell -2.100 1.1e-02
nephrosclerosis 1.131 2.1e-03
non-small cell lung cancer -1.278 1.8e-06
osteosarcoma -5.483 1.7e-05
ovarian cancer -1.200 3.6e-02
pediatric high grade glioma -1.900 1.0e-02
Pick disease 1.800 2.0e-03
posterior fossa group B ependymoma 1.400 4.2e-02
primitive neuroectodermal tumor -2.100 4.8e-02
psoriasis -1.700 9.5e-06
subependymal giant cell astrocytoma -1.280 4.6e-02
tuberculosis 1.100 7.2e-04

 OMIM Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (35)

AA Sequence

IMTTKNSNIYKMPLSKVTYPEENRIFYLQAKKRMVESPL                                   351 - 389

Text Mined References (61)

PMID Year Title