Property Summary

NCBI Gene PubMed Count 159
Grant Count 39
R01 Count 35
Funding $2,574,407.99
PubMed Score 184.67
PubTator Score 197.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.029
ependymoma 1.900 0.021
psoriasis -1.600 0.000
medulloblastoma 1.900 0.000
astrocytoma 1.600 0.018
atypical teratoid / rhabdoid tumor 1.900 0.000
glioblastoma 1.400 0.000
medulloblastoma, large-cell 2.500 0.000
primitive neuroectodermal tumor 1.100 0.000
autosomal dominant Emery-Dreifuss muscul... 1.086 0.003
juvenile dermatomyositis 1.202 0.000
lung cancer 1.400 0.000
gastric carcinoma 1.300 0.019
ovarian cancer 1.900 0.000

Gene RIF (130)

PMID Text
27048111 RNAi aiming at MTA1 can effectively inhibit the expression of MTA1 in endometrial carcinoma Ishikawa cells
26698569 We revealed a new molecular mechanism of MTA1-mediated invasion and metastasis in lung cancer through downstream target EpCAM, and interfering with EpCAM function may be a novel therapeutic strategy for treatment of MTA1-overexpressing lung carcinoma
26689197 MTA1 plays an important role in Epithelial-to-mesenchymal transition (EMT) to promote metastasis via suppressing E-cadherin expression, resulting in a poor prognosis in MPM. MTA1 is a novel biomarker and indicative of a poor prognosis in MPM patients
26543080 MTA1 is up-regulated in CRC; its expression is inversely associated with lymphatic metastases and the expression of VEGFC, VEGFD and VEGFR3
26503703 Inhibition of MTA1 by ERalpha contributes to protection hepatocellular carcinoma from tumor proliferation and metastasis
26168722 MTA1 dysregulation in a subset of salivary gland cancer might promote aggressive phenotypes by compromising the tumor suppressor activity of ERbeta
25998575 report demonstrates that miR-125a-3p inhibits the proliferation, migration, and invasion of NSCLC cells through down-regulation of MTA1
25977170 MTA1 is associated with the aggressive nature of pituitary tumors and may be a potential therapeutic target in this tumor type.
25797255 protein abundance of YB-1 and MTA1, irrespective of DNA or mRNA status, can predict for prostate cancer relapse and uncover a vast underappreciated repository of biomarkers regulated at the level of protein expression.
25688501 MTA1 might be important biological marker involved in the carcinogenesis, metastasis, and invasion of gallbladder adenocarcinoma, and MTA1 is an independent factor of prognosis.
More...

AA Sequence

MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALADKHATLSVCYK      1 - 70
AGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRGKCSVTLLNETESLKSY     71 - 140
LEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQI    141 - 210
DQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVL    211 - 280
CRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESK    281 - 350
LKQVYIPNYNKPNPNQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASC    351 - 420
WTYWKKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTRIARRLCREIL    421 - 490
RPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVL    491 - 560
SSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQARHMGPSRNLLLNGKSYPT    561 - 630
KVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP    631 - 700
PPPAPVNDEPIVIED                                                           701 - 715
//

Text Mined References (172)

PMID Year Title
27048111 2016 Effects of silencing MTA1 gene by RNA interference on invasion and metastasis of endometrial carcinoma.
26869315 2016 Structure, expression and functions of MTA genes.
26698569 2015 MTA1-upregulated EpCAM is associated with metastatic behaviors and poor prognosis in lung cancer.
26689197 2015 MTA1 promotes metastasis of MPM via suppression of E-cadherin.
26543080 MTA1 Is Up-regulated in Colorectal Cancer and Is Inversely Correlated with Lymphatic Metastasis.
26503703 2015 Inhibition of MTA1 by ER? contributes to protection hepatocellular carcinoma from tumor proliferation and metastasis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26168722 2015 MTA1 regulation of ER? pathway in salivary gland carcinoma cells.
26028330 2015 Dysfunction of the Reciprocal Feedback Loop between GATA3- and ZEB2-Nucleated Repression Programs Contributes to Breast Cancer Metastasis.
25998575 2015 miR-125a-3p targets MTA1 to suppress NSCLC cell proliferation, migration, and invasion.
More...