Property Summary

NCBI Gene PubMed Count 13
PubMed Score 20.00
PubTator Score 11.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Influenza 142
Disease Target Count P-value
psoriasis 6685 5.39839564233192E-39
juvenile dermatomyositis 1189 2.04223119812872E-15
ulcerative colitis 2087 1.03959022172153E-4
medulloblastoma, large-cell 6234 3.67646077904875E-4
systemic lupus erythematosus 172 3.88560028008299E-4
cutaneous lupus erythematosus 1056 4.8532995176443E-4
lung cancer 4473 5.09012744733317E-4
primary Sjogren syndrome 789 0.00281391767358214
active Crohn's disease 918 0.0165540014640019
Multiple Sclerosis 498 0.017710543555825
osteosarcoma 7933 0.0253524785245966
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0257060785299155
Disease Target Count Z-score Confidence
Avian influenza 8 4.452 2.2

Expression

  Differential Expression (12)

Synonym

Accession Q13325 B2R5X9 B4DDV1 Q5T7I9 Q6IAX3 IFIT-5
Symbols P58
RI58
ISG58

Gene

PDB

3ZGQ   4HOQ   4HOR   4HOS   4HOT   4J0U  

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid

Pathway (1)

Gene RIF (7)

PMID Text
26334375 IFIT5 promotes SeV-induced IKK phosphorylation and NF-kappaB activation by regulating the recruitment of IKK to TAK1.
25092312 show that IFIT5 binds precursor and processed tRNAs, as well as other RNA polymerase III transcripts. Our findings establish the RNA recognition specificity of the human innate immune response protein IFIT5
24311583 TRIF-N-terminal helical domain shares structural similarity with IFIT5.
23774268 IFIT5 consists of 24 alpha-helices that pack into a special "V"-like structure.
23334420 crystal structures of human IFIT5, its complex with PPP-RNAs, and an amino-terminal fragment of IFIT1
23317505 IFIT5 recognizes cellular RNA instead of protein partners.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSEIRKDTLKAILLELECHFTWNLLKEDIDLFEVEDTIGQQLEFLTTKSRLALYNLLAYVKHLKGQNKDA      1 - 70
LECLEQAEEIIQQEHSDKEEVRSLVTWGNYAWVYYHMDQLEEAQKYTGKIGNVCKKLSSPSNYKLECPET     71 - 140
DCEKGWALLKFGGKYYQKAKAAFEKALEVEPDNPEFNIGYAITVYRLDDSDREGSVKSFSLGPLRKAVTL    141 - 210
NPDNSYIKVFLALKLQDVHAEAEGEKYIEEILDQISSQPYVLRYAAKFYRRKNSWNKALELLKKALEVTP    211 - 280
TSSFLHHQMGLCYRAQMIQIKKATHNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAE    281 - 350
GGQYSNAEDIFRKALRLENITDDHKHQIHYHYGRFQEFHRKSENTAIHHYLEALKVKDRSPLRTKLTSAL    351 - 420
KKLSTKRLCHNALDVQSLSALGFVYKLEGEKRQAAEYYEKAQKIDPENAEFLTALCELRLSI            421 - 482
//

Text Mined References (17)

PMID Year Title
26334375 2015 IFIT5 positively regulates NF-?B signaling through synergizing the recruitment of I?B kinase (IKK) to TGF-?-activated kinase 1 (TAK1).
25092312 2014 Broad and adaptable RNA structure recognition by the human interferon-induced tetratricopeptide repeat protein IFIT5.
24311583 2013 The TLR signalling adaptor TRIF/TICAM-1 has an N-terminal helical domain with structural similarity to IFIT proteins.
23774268 2013 Crystal structure and nucleotide selectivity of human IFIT5/ISG58.
23334420 2013 Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
23317505 2013 tRNA binding, structure, and localization of the human interferon-induced protein IFIT5.
23237964 2013 The broad-spectrum antiviral functions of IFIT and IFITM proteins.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21642987 2011 IFIT1 is an antiviral protein that recognizes 5'-triphosphate RNA.
21269460 2011 Initial characterization of the human central proteome.
More...