Property Summary

NCBI Gene PubMed Count 13
PubMed Score 20.83
PubTator Score 11.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease 1.917 1.7e-02
cutaneous lupus erythematosus 2.100 4.9e-04
intraductal papillary-mucinous neoplasm ... 1.400 2.6e-02
juvenile dermatomyositis 2.205 2.0e-15
lung cancer -1.700 7.1e-05
medulloblastoma, large-cell -1.200 3.7e-04
Multiple Sclerosis 1.500 1.8e-02
osteosarcoma 1.101 2.5e-02
primary Sjogren syndrome 1.100 2.8e-03
psoriasis 1.100 5.4e-39
Systemic lupus erythematosus 1.200 3.9e-04
ulcerative colitis 1.200 1.0e-04

Gene RIF (7)

AA Sequence

MSEIRKDTLKAILLELECHFTWNLLKEDIDLFEVEDTIGQQLEFLTTKSRLALYNLLAYVKHLKGQNKDA      1 - 70
LECLEQAEEIIQQEHSDKEEVRSLVTWGNYAWVYYHMDQLEEAQKYTGKIGNVCKKLSSPSNYKLECPET     71 - 140
DCEKGWALLKFGGKYYQKAKAAFEKALEVEPDNPEFNIGYAITVYRLDDSDREGSVKSFSLGPLRKAVTL    141 - 210
NPDNSYIKVFLALKLQDVHAEAEGEKYIEEILDQISSQPYVLRYAAKFYRRKNSWNKALELLKKALEVTP    211 - 280
TSSFLHHQMGLCYRAQMIQIKKATHNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAE    281 - 350
GGQYSNAEDIFRKALRLENITDDHKHQIHYHYGRFQEFHRKSENTAIHHYLEALKVKDRSPLRTKLTSAL    351 - 420
KKLSTKRLCHNALDVQSLSALGFVYKLEGEKRQAAEYYEKAQKIDPENAEFLTALCELRLSI            421 - 482
//

Text Mined References (17)

PMID Year Title