Property Summary

NCBI Gene PubMed Count 13
Grant Count 38
R01 Count 30
Funding $3,854,070.03
PubMed Score 20.00
PubTator Score 11.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (7)

PMID Text
26334375 IFIT5 promotes SeV-induced IKK phosphorylation and NF-kappaB activation by regulating the recruitment of IKK to TAK1.
25092312 show that IFIT5 binds precursor and processed tRNAs, as well as other RNA polymerase III transcripts. Our findings establish the RNA recognition specificity of the human innate immune response protein IFIT5
24311583 TRIF-N-terminal helical domain shares structural similarity with IFIT5.
23774268 IFIT5 consists of 24 alpha-helices that pack into a special "V"-like structure.
23334420 crystal structures of human IFIT5, its complex with PPP-RNAs, and an amino-terminal fragment of IFIT1
23317505 IFIT5 recognizes cellular RNA instead of protein partners.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSEIRKDTLKAILLELECHFTWNLLKEDIDLFEVEDTIGQQLEFLTTKSRLALYNLLAYVKHLKGQNKDA      1 - 70
LECLEQAEEIIQQEHSDKEEVRSLVTWGNYAWVYYHMDQLEEAQKYTGKIGNVCKKLSSPSNYKLECPET     71 - 140
DCEKGWALLKFGGKYYQKAKAAFEKALEVEPDNPEFNIGYAITVYRLDDSDREGSVKSFSLGPLRKAVTL    141 - 210
NPDNSYIKVFLALKLQDVHAEAEGEKYIEEILDQISSQPYVLRYAAKFYRRKNSWNKALELLKKALEVTP    211 - 280
TSSFLHHQMGLCYRAQMIQIKKATHNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAE    281 - 350
GGQYSNAEDIFRKALRLENITDDHKHQIHYHYGRFQEFHRKSENTAIHHYLEALKVKDRSPLRTKLTSAL    351 - 420
KKLSTKRLCHNALDVQSLSALGFVYKLEGEKRQAAEYYEKAQKIDPENAEFLTALCELRLSI            421 - 482
//

Text Mined References (17)

PMID Year Title
26334375 2015 IFIT5 positively regulates NF-?B signaling through synergizing the recruitment of I?B kinase (IKK) to TGF-?-activated kinase 1 (TAK1).
25092312 2014 Broad and adaptable RNA structure recognition by the human interferon-induced tetratricopeptide repeat protein IFIT5.
24311583 2013 The TLR signalling adaptor TRIF/TICAM-1 has an N-terminal helical domain with structural similarity to IFIT proteins.
23774268 2013 Crystal structure and nucleotide selectivity of human IFIT5/ISG58.
23334420 2013 Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
23317505 2013 tRNA binding, structure, and localization of the human interferon-induced protein IFIT5.
23237964 2013 The broad-spectrum antiviral functions of IFIT and IFITM proteins.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21642987 2011 IFIT1 is an antiviral protein that recognizes 5'-triphosphate RNA.
21269460 2011 Initial characterization of the human central proteome.
More...