Property Summary

NCBI Gene PubMed Count 93
Grant Count 358
R01 Count 181
Funding $27,463,107.26
PubMed Score 247.68
PubTator Score 150.99

Knowledge Summary

Patent (22,270)

Expression

Synonym

Accession Q13324 B2R967 B3SXS6 B3SXS7 B3SXS8 B3SXT0 F8WA81 O43461 Q4QRJ4 Q99431 CRF-R-2
Symbols CRF2
CRFR2
CRF-RB
HM-CRF

Gene

PDB

3N95   3N93   3N96  

  TechDev Info (1)

 GWAS Trait (1)

Gene RIF (76)

PMID Text
26808377 found associations between CRHR2 genotypes and haplotypes and negative emotion in IBS patients and controls
26597886 Wound healing and signal transducer and activator of transcription 3 activity were elevated in CRHR2-overexpressing cells after urocortin 2 and IL-6 treatment, suggesting advanced healing progression
25672976 This study demonstrated that CRF2 Receptor Deficiency Eliminates the Long-Lasting Vulnerability of Motivational States Induced by Opiate Withdrawal.
25426872 not up-regulated by labor in placenta, fetal membranes, or myometrium
25172671 no difference in placental expression between intrahepatic cholestasis of pregnancy and controls
25073922 D1 and CRF2 alpha receptors are capable of heterodimerization in living cells. D1 /CRF2 alpha receptor heteromerization might account, at least in part, for the complex physiological interactions established between dopamine and CRH.
24485608 HSF2 element confers estrogen up-regulation of CRHR2 transcription and estrogen increases CRHR2 transcription via induction of HSF2 demethylation.
24123648 Results suggest CRHR-2 variants may affect risk for PTSD in women by attenuating the stress response and reducing symptoms of the disorder.
24107226 CRFR2 antagonist astressin-2B abrogated the effects of UCN2 on VSMCs. In conclusion, UCN2 is significantly associated with AAA and inhibits VSMC proliferation by inducing a G1 cell cycle arrest suggesting a plausible regulatory role in AAA pathogenesis
23982282 These results fail to provide support for an association of CRHR1 and CRHR2 with personality traits in a Japanese adult population.
More...

AA Sequence

MDAALLHSLLEANCSLALAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNG      1 - 70
VKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLA     71 - 140
LRSIRCLRNVIHWNLITTFILRNVMWFLLQLVDHEVHESNEVWCRCITTIFNYFVVTNFFWMFVEGCYLH    141 - 210
TAIVMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINF    211 - 280
VFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSF    281 - 350
QGFFVSVFYCFFNGEVRSAVRKRWHRWQDHHSLRVPMARAMSIPTSPTRISFHSIKQTAAV             351 - 411
//

Text Mined References (95)

PMID Year Title
26808377 2016 Corticotropin-Releasing Hormone Receptor 2 Gene Variants in Irritable Bowel Syndrome.
26597886 2016 Corticotropin-Releasing Hormone Receptor 2 Signaling Promotes Mucosal Repair Responses after Colitis.
25672976 2015 CRF2 Receptor Deficiency Eliminates the Long-Lasting Vulnerability of Motivational States Induced by Opiate Withdrawal.
25426872 2015 Urocortin 2 role in placental and myometrial inflammatory mechanisms at parturition.
25172671 2014 Expression of urocortin and corticotrophin-releasing hormone receptor-2 in patients with intrahepatic cholestasis of pregnancy.
25073922 2014 Dopamine D1 and corticotrophin-releasing hormone type-2? receptors assemble into functionally interacting complexes in living cells.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24485608 2014 Estrogen up-regulates CRHR2 expression via demethylation of CRHR2 gene promoter in cardiomyocytes.
24123648 2013 Corticotropin releasing hormone receptor 2 (CRHR-2) gene is associated with decreased risk and severity of posttraumatic stress disorder in women.
24107226 2014 Urocortin 2 is associated with abdominal aortic aneurysm and mediates anti-proliferative effects on vascular smooth muscle cells via corticotrophin releasing factor receptor 2.
More...