Property Summary

NCBI Gene PubMed Count 93
PubMed Score 247.68
PubTator Score 150.99

Knowledge Summary

Patent (22,270)

Expression

 GWAS Trait (1)

Gene RIF (76)

PMID Text
26808377 found associations between CRHR2 genotypes and haplotypes and negative emotion in IBS patients and controls
26597886 Wound healing and signal transducer and activator of transcription 3 activity were elevated in CRHR2-overexpressing cells after urocortin 2 and IL-6 treatment, suggesting advanced healing progression
25672976 This study demonstrated that CRF2 Receptor Deficiency Eliminates the Long-Lasting Vulnerability of Motivational States Induced by Opiate Withdrawal.
25426872 not up-regulated by labor in placenta, fetal membranes, or myometrium
25172671 no difference in placental expression between intrahepatic cholestasis of pregnancy and controls
25073922 D1 and CRF2 alpha receptors are capable of heterodimerization in living cells. D1 /CRF2 alpha receptor heteromerization might account, at least in part, for the complex physiological interactions established between dopamine and CRH.
24485608 HSF2 element confers estrogen up-regulation of CRHR2 transcription and estrogen increases CRHR2 transcription via induction of HSF2 demethylation.
24123648 Results suggest CRHR-2 variants may affect risk for PTSD in women by attenuating the stress response and reducing symptoms of the disorder.
24107226 CRFR2 antagonist astressin-2B abrogated the effects of UCN2 on VSMCs. In conclusion, UCN2 is significantly associated with AAA and inhibits VSMC proliferation by inducing a G1 cell cycle arrest suggesting a plausible regulatory role in AAA pathogenesis
23982282 These results fail to provide support for an association of CRHR1 and CRHR2 with personality traits in a Japanese adult population.
23821771 Data indicate that estrogen increased the abundance of the mRNA encoding CRH-R2 and an alternative splice variant encoding CRH-R1 in which exon 12 was deleted [CRH-R1(Delta12)].
23820308 The rate and extent of homologous CRF2(a) receptor desensitization is governed by agonist-specific mechanisms affecting G protein-coupled receptor kinase phosphorylation.
23539366 The down-regulation of the CRF2 receptor in the distal/sigmoid biopsies of ulcerative colitis patients is indicative of change in CRF2 signalling associated with the process of inflammation.
23177644 Polymorphisms within CRHR1 and CRHR2 genes interacted with both childhood sexual abuse and emotional neglect to influence Iowa Gambling Task performance.
23168683 Suggest that urocortin 1 increase LPS-induced endothelial permeability by disrupting the VE-cadherin-beta-catenin complex via activation of CRHR2.
22467522 12 single nucleotide polymorphisms (SNPs) CRHR1 and CRHR2 in major depressive disorder patients (n = 173), panic disorder patients (n = 180), and healthy controls, were investigated.
22234467 in placenta, CRH produced locally regulates GLUT1 and GLUT3 expression, CRHR1 and CRHR2-mediated differential regulation of GLUT1 and GLUT3 expression
21487655 data suggest a prominent role of CRF(1) in stressor-induced changes in EtOH consumption, with involvement of CRF(2) in recovery from stressor effects
21338628 These findings reveal a complex interplay between the signaling molecules that allow "fine-tuning" of CRH-R2beta functional responses and regulate signal integration.
20966082 Structural basis for hormone recognition by the Human CRFR2{alpha} G protein-coupled receptor.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20630588 both CRF receptors were found in breast cancer and the respective benign adjacent tissue. The two CRF receptor proteins presented distinct distribution and subcellular localization, pointing into differing biological roles.
20602615 Observational study of gene-disease association. (HuGE Navigator)
20594969 cross-talk between corticotropin-releasing factor (CRF) and muscarinic receptors
20487506 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20368512 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
20164545 Investigated whether a genetic variation in CRHR2 gene might be associated with preterm birth. The polymorphism does not increase the risk for preterm birth overall but might modulate the length of pregnancy in a dose dependent fashion in Caucasian women.
20164545 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19813023 Results suggest that the rs2267716 polymorphism in the CRHR2 gene might influence the risk of developing HCC in patients with HBV infection in Chinese population.
19813023 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19437022 nuclear translocation of Ucn along with the loss of CRFR2 in epithelial cells and microvasculature of tumoral specimens may be involved in the pathobiology of renal cell carcinoma
19433256 CRH-R1 and CRH-R2 receptors and their endogenous ligands have a role in the biology of human endometrial cancer.
19417223 Trophoblast cell cultures treated with increasing amounts of type 2 corticotrophin releasing hormone receptor mediate increased secretion of estradiol in the presence of androstenedione.
19351656 the SCP/CRHR2 system is present in human ovaries and treatment with SCP/Ucn3 inhibits progesterone production by cultured granulosa-lutein cells through interaction with CRHR2
19131402 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19098121 receptors couple to different G-proteins in stably transfected human cells, leading to transient divalent calcium ion mobilization on top of the natural increase in cyclic AMP stimulation.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19058138 Expression loss of CRFR2 in prostate cancer and its neovascularization contributes to prostate tumorigenesis, progression, and neoangiogenesis.
19019335 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18838498 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18443956 UCN inhibited the proliferation and promoted the apoptosis of endothelial cells and down-regulated VEGF expression in vivo via CRFR2.
18408560 Association of corticotropin-releasing hormone receptor-2 genetic variants with acute bronchodilator response in asthma.
18408560 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18384079 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18325997 Cultured placental trophoblasts express both CRH-R1 and CRH-R2.
17959885 Human myometrium expresses both CRH-R1 and CRH-R2 during pregnancy.
17532191 Observational study of gene-disease association. (HuGE Navigator)
17532191 results show that haplotype variation at the CRHR2 locus is associated with suicidal behaviour
17463062 in chorion trophoblast cells, CRHR1 and CRHR2 mediate divergent effects on PGDH expression, and this may provide a precise regulation of PGs levels from chorion to myometrium during pregnancy
17170072 Both CRHR1 and CRHR2 play a facilitatory role in the non-clathrin-, non-caveolae-mediated endocytosis and intracellular signal transduction of urocortin.
16972272 Results demonstrate corticotropin-releasing factor (2) expression in the human gastric mucosa and indicate a physiological role of this receptor type in regulating apoptosis, an important parameter of gastric cell regeneration.
16884458 Observational study of gene-disease association. (HuGE Navigator)
16734917 expression of CRH-BP, CRH-R1 and CRH-R2 in uterine tissues is down-regulated during pregnancy; the most pronounced down-regulation of CRH-BP and CRH-R2 occurred in laboring cervix, irrespective the length of gestation
16721033 adrenocortical cells exhibit a higher expression of functional CRH receptors than chromaffin cells and that CRH acts on adrenal DHEA production
16691126 Observational study of gene-disease association. (HuGE Navigator)
16691126 CRHR2 polymorphisms examined do not confer susceptibility to panic disorder.
16326828 expression by semiquantitative reverse transcriptase-polymerase chain reaction (RT-PCR) and fluorescent immunocytochemistry in umbilical cord blood-derived cultured mast cells
16175604 Observational study of gene-disease association. (HuGE Navigator)
15924674 There is no significant difference between the expression of CRH-R2beta mRNA of preeclampsia and of normal pregnancies.
15652653 ligand binding properties of CRFR2
15331578 The regions of the CRF2(a) promoter that regulate the inducible expression were determined
14764822 CRH-R1:CRH-R2 ratio varied according to fat-depot type; whereas CRH-R1 expression was higher in sc fat than in visceral fat, the opposite was true for CRH-R2.
14724656 Observational study of gene-disease association. (HuGE Navigator)
14592950 data suggest a distinctive role for corticotropin-releasing hormone receptor 2 specific agonists like urocortin II in the control of myometrial contractility during human pregnancy
12784189 Detected in placenta, myometrium, decidua, and fetal membranes. Widespread expression of CRH system in gestational tissue suggests paracrine role CRH in birth process (e.g. effects on macrophages and endothelial cells).
11857585 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDAALLHSLLEANCSLALAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNG      1 - 70
VKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLA     71 - 140
LRSIRCLRNVIHWNLITTFILRNVMWFLLQLVDHEVHESNEVWCRCITTIFNYFVVTNFFWMFVEGCYLH    141 - 210
TAIVMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINF    211 - 280
VFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSF    281 - 350
QGFFVSVFYCFFNGEVRSAVRKRWHRWQDHHSLRVPMARAMSIPTSPTRISFHSIKQTAAV             351 - 411
//

Text Mined References (95)

PMID Year Title
26808377 2016 Corticotropin-Releasing Hormone Receptor 2 Gene Variants in Irritable Bowel Syndrome.
26597886 2016 Corticotropin-Releasing Hormone Receptor 2 Signaling Promotes Mucosal Repair Responses after Colitis.
25672976 2015 CRF2 Receptor Deficiency Eliminates the Long-Lasting Vulnerability of Motivational States Induced by Opiate Withdrawal.
25426872 2015 Urocortin 2 role in placental and myometrial inflammatory mechanisms at parturition.
25172671 2014 Expression of urocortin and corticotrophin-releasing hormone receptor-2 in patients with intrahepatic cholestasis of pregnancy.
25073922 2014 Dopamine D1 and corticotrophin-releasing hormone type-2? receptors assemble into functionally interacting complexes in living cells.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24485608 2014 Estrogen up-regulates CRHR2 expression via demethylation of CRHR2 gene promoter in cardiomyocytes.
24123648 2013 Corticotropin releasing hormone receptor 2 (CRHR-2) gene is associated with decreased risk and severity of posttraumatic stress disorder in women.
24107226 2014 Urocortin 2 is associated with abdominal aortic aneurysm and mediates anti-proliferative effects on vascular smooth muscle cells via corticotrophin releasing factor receptor 2.
23982282 2013 Association between corticotropin-releasing hormone receptor 1 and 2 (CRHR1 and CRHR2) gene polymorphisms and personality traits.
23821771 2013 Estrogen alters the splicing of type 1 corticotropin-releasing hormone receptor in breast cancer cells.
23820308 2013 Desensitization of human CRF2(a) receptor signaling governed by agonist potency and ?arrestin2 recruitment.
23539366 2013 Corticotropin-releasing factor receptor subtype 2 in human colonic mucosa: down-regulation in ulcerative colitis.
23177644 2013 HPA axis genes may modulate the effect of childhood adversities on decision-making in suicide attempters.
23168683 2013 Urocortin increased LPS-induced endothelial permeability by regulating the cadherin-catenin complex via corticotrophin-releasing hormone receptor 2.
22689579 2012 The Pseudo signal peptide of the corticotropin-releasing factor receptor type 2A prevents receptor oligomerization.
22467522 2012 Association of CRHR1 and CRHR2 with major depressive disorder and panic disorder in a Japanese population.
22234467 2012 Differential regulation of glucose transporters mediated by CRH receptor type 1 and type 2 in human placental trophoblasts.
21487655 2011 Ethanol concentration-dependent effects and the role of stress on ethanol drinking in corticotropin-releasing factor type 1 and double type 1 and 2 receptor knockout mice.
21338628 2011 Molecular determinants and feedback circuits regulating type 2 CRH receptor signal integration.
20966082 2010 Structural basis for hormone recognition by the Human CRFR2{alpha} G protein-coupled receptor.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20630588 2010 Distinct distribution of corticotropin releasing factor receptors in human breast cancer.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20594969 2010 Corticotropin-releasing factor receptors induce calcium mobilization through cross-talk with Gq-coupled receptors.
20487506 2010 A whole genome association study of mother-to-child transmission of HIV in Malawi.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20368512 2010 Association of polymorphisms in genes regulating the corticotropin-releasing factor system with antidepressant treatment response.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20164545 2010 A polymorphism of the corticotropin-releasing hormone receptor 2 (CRHR2) and preterm birth.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19813023 2010 An intronic polymorphism in the corticotropin-releasing hormone receptor 2 gene increases susceptibility to HBV-related hepatocellular carcinoma in Chinese population.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19437022 2009 Urocortin and corticotropin-releasing factor receptor 2 in human renal cell carcinoma: disruption of an endogenous inhibitor of angiogenesis and proliferation.
19433256 2009 Expression and subcellular localization of CRH and its receptors in human endometrial cancer.
19417223 2009 Urocortin 2 stimulates estradiol secretion from cultured human placental cells: an effect mediated by the type 2 corticotrophin-releasing hormone (CRH) receptor.
19351656 2009 Suppression of progesterone production by stresscopin/urocortin 3 in cultured human granulosa-lutein cells.
19131402 2009 Predicting risk of bacterial vaginosis: the role of race, smoking and corticotropin-releasing hormone-related genes.
19098121 2009 Molecular mechanisms of corticotropin-releasing factor receptor-induced calcium signaling.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19058138 2009 The involvement of altered corticotropin releasing factor receptor 2 expression in prostate cancer due to alteration of anti-angiogenic signaling pathways.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18838498 2010 Association of HPA axis genes with suicidal behaviour in schizophrenia.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18443956 2008 Urocortin's inhibition of tumor growth and angiogenesis in hepatocellular carcinoma via corticotrophin-releasing factor receptor 2.
18408560 2008 Association of corticotropin-releasing hormone receptor-2 genetic variants with acute bronchodilator response in asthma.
18384079 2008 Combined effects of exonic polymorphisms in CRHR1 and AVPR1B genes in a case/control study for panic disorder.
18325997 2008 Differential regulation of prostaglandin production mediated by corticotropin-releasing hormone receptor type 1 and type 2 in cultured human placental trophoblasts.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17959885 2007 Expression of corticotropin-releasing hormone receptor type 1 and type 2 in human pregnant myometrium.
17532191 2007 Association study between the corticotropin-releasing hormone receptor 2 gene and suicidality in bipolar disorder.
17463062 2007 Corticotropin-releasing hormone receptor type 1 and type 2 mediate differential effects on 15-hydroxy prostaglandin dehydrogenase expression in cultured human chorion trophoblasts.
17170072 2007 Corticotropin-releasing hormone receptor (CRHR)1 and CRHR2 are both trafficking and signaling receptors for urocortin.
16972272 2006 Corticotropin-releasing factor (CRF) receptor type 2 in the human stomach: protective biological role by inhibition of apoptosis.
16884458 2006 Association between corticotropin-releasing hormone receptor 2 (CRHR2) gene polymorphism and personality traits.
16734917 2006 Corticotropin-releasing hormone, its binding protein and receptors in human cervical tissue at preterm and term labor in comparison to non-pregnant state.
16721033 2005 Corticotropin-releasing hormone receptor expression on normal and tumorous human adrenocortical cells.
16691126 2006 Lack of association between the corticotrophin-releasing hormone receptor 2 gene and panic disorder.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16326828 2005 Regulation of corticotropin-releasing hormone receptor-2 expression in human cord blood-derived cultured mast cells.
16175604 2005 Large-scale search of single nucleotide polymorphisms for hepatocellular carcinoma susceptibility genes in patients with hepatitis C.
15924674 2005 [Study on the level of placental urocortin and corticotropin-releasing hormone receptor 2beta of preeclampsia].
15652653 2005 Peptide ligand binding properties of the corticotropin-releasing factor (CRF) type 2 receptor: pharmacology of endogenously expressed receptors, G-protein-coupling sensitivity and determinants of CRF2 receptor selectivity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15331578 2004 Characterization of the human corticotropin-releasing factor2(a) receptor promoter: regulation by glucocorticoids and the cyclic adenosine 5'-monophosphate pathway.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14764822 2004 Corticotropin-releasing hormone system in human adipose tissue.
14724656 2004 Genetic variation in the corticotrophin-releasing factor receptors: identification of single-nucleotide polymorphisms and association studies with obesity in UK Caucasians.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14592950 2004 Urocortin II is expressed in human pregnant myometrial cells and regulates myosin light chain phosphorylation: potential role of the type-2 corticotropin-releasing hormone receptor in the control of myometrial contractility.
12853948 2003 The DNA sequence of human chromosome 7.
12784189 2003 Expression patterns of CRH, CRH receptors, and CRH binding protein in human gestational tissue at term.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11857585 2002 Gene-based SNP genetic association study of the corticotropin-releasing hormone receptor-2 (CRHR2) in major depression.
11416224 2001 Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor.
11329063 2001 Human stresscopin and stresscopin-related peptide are selective ligands for the type 2 corticotropin-releasing hormone receptor.
11226328 2001 Urocortin II: a member of the corticotropin-releasing factor (CRF) neuropeptide family that is selectively bound by type 2 CRF receptors.
11117536 2000 Urocortin, but not corticotropin-releasing hormone (CRH), activates the mitogen-activated protein kinase signal transduction pathway in human pregnant myometrium: an effect mediated via R1alpha and R2beta CRH receptor subtypes and stimulation of Gq-proteins.
10822340 2000 Effects of a novel corticotropin-releasing-hormone receptor type I antagonist on human adrenal function.
9717834 1998 Molecular identification and analysis of a novel human corticotropin-releasing factor (CRF) receptor: the CRF2gamma receptor.
9423932 1997 Labelling of CRF1 and CRF2 receptors using the novel radioligand, [3H]-urocortin.
9199241 1997 A new functional isoform of the human CRF2 receptor for corticotropin-releasing factor.
9070940 1997 Localization of the human CRF2 receptor to 7p21-p15 by radiation hybrid mapping and FISH analysis.
8612563 1996 Cloning and characterization of human urocortin.
8536644 1996 Cloning and characterization of the human corticotropin-releasing factor-2 receptor complementary deoxyribonucleic acid.
8243338 1993 Cloning and functional expression of a rat brain corticotropin releasing factor (CRF) receptor.