Property Summary

NCBI Gene PubMed Count 72
PubMed Score 127.28
PubTator Score 117.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
breast carcinoma 1.200 3.1e-04
ductal carcinoma in situ 2.400 1.1e-03
intraductal papillary-mucinous adenoma (... 1.300 5.0e-05
intraductal papillary-mucinous carcinoma... 1.100 2.4e-03
intraductal papillary-mucinous neoplasm ... 2.200 2.4e-04
invasive ductal carcinoma 2.800 3.6e-05
lung adenocarcinoma 1.600 1.7e-06
lung cancer 2.000 7.7e-04
non-small cell lung cancer 1.818 1.5e-13
ovarian cancer 1.600 1.1e-06
pancreatic cancer 1.300 2.8e-02
pancreatic carcinoma 1.300 2.8e-02
psoriasis 1.400 3.2e-44

Gene RIF (45)

AA Sequence

MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDV      1 - 70
SLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLAL     71 - 140
LLLLALLLPLLSGGLHLLLK                                                      141 - 160
//

Text Mined References (72)

PMID Year Title