Property Summary

NCBI Gene PubMed Count 66
Grant Count 42
R01 Count 25
Funding $3,397,786.13
PubMed Score 123.36
PubTator Score 117.66

Knowledge Summary

Patent

No data available

Expression

Gene RIF (42)

PMID Text
25861752 our data demonstrated that suppression of BIK in ER-positive MCF-7 cells prevents the cytotoxic effect of TAM and favors a more aggressive phenotype, due to the molecular change of different pathways
25463603 HCV RNA replication and release were significantly suppressed in BIK-depleted cells and over-expression of the RNA-dependent RNA polymerase, NS5B, was able to induce BIK expression
25002530 Findings identify novel cross talk between autophagy and apoptosis, wherein targeting SQSTM1/p62 converts cytoprotective autophagy to an inefficient form due to cargo loading failure, leading to NBK/Bik accumulation, which triggers apoptosis.
24637719 BikDDA, a novel mutant of Bik, showed a prolonged half-life and enhanced pro-apoptotic ability in triple-negative breast cancer cells compared with BikDD.
24554662 Authors show that human herpesvirus 4 EBNA2 represses BIK in B-cell lymphoma-derived cell lines and that this host-virus interaction can inhibit the proapoptotic effect of transforming growth factor beta1.
24527759 Data suggest BIK expression in tumor cells is not subject to direct regulation by MAP kinase signaling; BIK expression appears to be cell-cycle-dependent and increases in G1 cell-cycle arrest which results from inhibition of MAP kinase signaling.
22873408 A previously undescribed indirect epigenetic regulation of BIK in FA-C lymphoblasts is mediated by DeltaNp73, an isoform of p73 lacking its transactivation domain that activates BIK through a proximal element in its promoter.
22855140 BIK/NBK gene expression may have important clinical implications and provide predictive, prognostic or therapeutic marker in breast cancer patients
22388352 Src tyrosine kinase inhibits apoptosis through the Erk1/2- dependent degradation of the death accelerator Bik.
22288719 Data indicate that methylation-induced transcriptional silencing of the BIK (bcl2-interacting killer) pro-apoptotic gene may occur in multiple myeloma (MM), which might serve as a predictor of the development of relapsed/refractory MM.
More...

AA Sequence

MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDV      1 - 70
SLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLAL     71 - 140
LLLLALLLPLLSGGLHLLLK                                                      141 - 160
//

Text Mined References (66)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25861752 2015 Involvement of multiple cellular pathways in regulating resistance to tamoxifen in BIK-suppressed MCF-7 cells.
25463603 2015 NS5B induces up-regulation of the BH3-only protein, BIK, essential for the hepatitis C virus RNA replication and viral release.
25416956 2014 A proteome-scale map of the human interactome network.
25002530 2014 Targeting SQSTM1/p62 induces cargo loading failure and converts autophagy to apoptosis via NBK/Bik.
24637719 2014 BikDDA, a mutant of Bik with longer half-life expression protein, can be a novel therapeutic gene for triple-negative breast cancer.
24554662 2014 Repression of the proapoptotic cellular BIK/NBK gene by Epstein-Barr virus antagonizes transforming growth factor ?1-induced B-cell apoptosis.
24527759 2014 The increase in BIK expression following ERK1/2 pathway inhibition is a consequence of G? cell-cycle arrest and not a direct effect on BIK protein stability.
22873408 2012 BIK (NBK) is a mediator of the sensitivity of Fanconi anaemia group C lymphoblastoid cell lines to interstrand DNA cross-linking agents.
22855140 2012 BIK/NBK gene as potential marker of prognostic and therapeutic target in breast cancer patients.
More...