Property Summary

NCBI Gene PubMed Count 63
PubMed Score 45.48
PubTator Score 181.32

Knowledge Summary

Patent

No data available

Expression

Gene RIF (51)

AA Sequence

MKISILLMFLWGLSCALPVTRYQNNESEDSEEWKGHLAQAPTPPLESSESSEGSKVSSEEQANEDPSDST      1 - 70
QSEEGLGSDDHQYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDS     71 - 140
DDTIQASEESAPQGQDSAQDTTSESRELDNEDRVDSKPEGGDSTQESESEEHWVGGGSDGESSHGDGSEL    141 - 210
DDEGMQSDDPESIRSERGNSRMNSAGMKSKESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRS    211 - 280
ELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEESQNVDGPSSESSQEANLSSQE    281 - 350
NSSESQEEVVSESRGDNPDPTTSYVEDQEDSDSSEEDSSHTLSHSKSESREEQADSESSESLNFSEESPE    351 - 420
SPEDENSSSQEGLQSHSSSAESQSEESHSEEDDSDSQDSSRSKEDSNSTESKSSSEEDGQLKNIEIESRK    421 - 490
LTVDAYHNKPIGDQDDNDCQDGY                                                   491 - 513
//

Text Mined References (65)

PMID Year Title