Property Summary

NCBI Gene PubMed Count 61
Grant Count 190
R01 Count 106
Funding $22,636,398.58
PubMed Score 39.57
PubTator Score 181.32

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13316 A1L4L3 O43265 DMP-1
Symbols ARHP
ARHR
DMP-1

Gene

Gene RIF (49)

PMID Text
26802432 This review will focus on the aberrant splicing of tumor suppressor/oncogenes that belong to the DMP1-ARF-MDM2-p53 pathway
25678029 DMP-1 immunostaining was higher for MTA and PC, confirming the reparative and bioinductive capacity of these materials.
25630512 The findings indicate that DMP-1 is a useful marker of osteogenic differentiation and mineralisation in soft tissue tumours
25578972 Expressions of dentin matrix protein (DMP)-1 and osteopontin (OPN) were observed in both normal dentin and dentin from DGI-I affected patients, without significant differences
25537728 identify alternative splicing as a mechanism utilized by cancer cells to modulate the DMP1 locus through diminishing DMP1alpha tumour suppressor expression
25180662 A family of autosomal recessive form of Hypophosphatemic rickets secondary to a DMP1 mutation located in the first coding exon of the gene, is reported.
25026495 Results suggest that FAM20C suppresses FGF23 production by enhancing DMP1 expression, and inactivating mutations in FAM20C cause FGF23-related hypophosphatemia by decreasing transcription of DMP1.
24987156 DMP1 may play an important role in maintaining the chondrogenic phenotype and its possible involvement in altered cartilage matrix remodelling and degradation in disease conditions like osteoarthritis.
24441185 DMP1 and DSPP were more abundant in carious than in sound samples.
23559304 DMP-1 is a matrix marker expressed around osteocytes in human woven and lamellar bone and is useful in identifying osteosarcoma and other bone-forming tumours.
More...

AA Sequence

MKISILLMFLWGLSCALPVTRYQNNESEDSEEWKGHLAQAPTPPLESSESSEGSKVSSEEQANEDPSDST      1 - 70
QSEEGLGSDDHQYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDS     71 - 140
DDTIQASEESAPQGQDSAQDTTSESRELDNEDRVDSKPEGGDSTQESESEEHWVGGGSDGESSHGDGSEL    141 - 210
DDEGMQSDDPESIRSERGNSRMNSAGMKSKESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRS    211 - 280
ELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEESQNVDGPSSESSQEANLSSQE    281 - 350
NSSESQEEVVSESRGDNPDPTTSYVEDQEDSDSSEEDSSHTLSHSKSESREEQADSESSESLNFSEESPE    351 - 420
SPEDENSSSQEGLQSHSSSAESQSEESHSEEDDSDSQDSSRSKEDSNSTESKSSSEEDGQLKNIEIESRK    421 - 490
LTVDAYHNKPIGDQDDNDCQDGY                                                   491 - 513
//

Text Mined References (63)

PMID Year Title
26802432 2016 Aberrant splicing of the DMP1-ARF-MDM2-p53 pathway in cancer.
25678029 2016 Immunolocalization of dentin matrix protein-1 in human primary teeth treated with different pulp capping materials.
25630512 2015 Dentine matrix protein 1 (DMP-1) is a marker of bone formation and mineralisation in soft tissue tumours.
25578972 2014 Immunocytochemical detection of dentin matrix proteins in primary teeth from patients with dentinogenesis imperfecta associated with osteogenesis imperfecta.
25537728 2015 DMP1?, a splice isoform of the tumour suppressor DMP1 locus, induces proliferation and progression of breast cancer.
25180662 2014 Exome sequencing reveals a mutation in DMP1 in a family with familial sclerosing bone dysplasia.
25026495 2014 Functional analysis of mutant FAM20C in Raine syndrome with FGF23-related hypophosphatemia.
24987156 2014 Role of dentin matrix protein 1 in cartilage redifferentiation and osteoarthritis.
24441185 2013 Dentin matrix protein 1 and dentin sialophosphoprotein in human sound and carious teeth: an immunohistochemical and colorimetric assay.
23559304 2013 Dentine matrix protein 1 (DMP-1) is a marker of bone-forming tumours.
More...