Property Summary

NCBI Gene PubMed Count 29
PubMed Score 8.32
PubTator Score 9.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
IGA Glomerulonephritis 454

Expression

Synonym

Accession Q13310 B1ANQ8 Q4VC03 Q6P0N3 PABP-4
Symbols APP1
APP-1
PABP4
iPABP

Gene

Gene RIF (10)

PMID Text
26005159 The PABPC4 rs4660293 SNP is associated with serum lipid levels.
23300856 although function of PABPN1 may be compensated by nuclear translocation of PABP4 and perhaps by increase the cytoplasmic abundance of PABP5, these were not sufficient to prevent apoptosis of cells. PABPN1 may have an anti apoptotic role in mammalian cells
23125841 Tandem affinity purification and mass spectrometry analysis identify cytoplasmic poly(A) binding protein 4 (PABPC4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify cytoplasmic poly(A) binding protein 4 (PABPC4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify cytoplasmic poly(A) binding protein 4 (PABPC4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify cytoplasmic poly(A) binding protein 4 (PABPC4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22884093 PABPC4 is highly expressed in human colorectal cancer.
21940797 Nuclear relocalisation of cytoplasmic poly(A)-binding proteins PABP1 and PABP4 in response to UV irradiation reveals mRNA-dependent export
21646427 RNA binding masks nuclear import signals within the cytoplasmic poly(A) binding protein RNA recognition motifs, thereby ensuring ef fi cient cytoplasmic retention of this protein in normal cells
19956697 Tandem affinity purification and mass spectrometry analysis identify cytoplasmic poly(A) binding protein 4 (PABPC4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALD      1 - 70
TMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGY     71 - 140
AFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKEL    141 - 210
FSQFGKTLSVKVMRDPNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKF    211 - 280
EQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAV    281 - 350
TEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRP    351 - 420
PYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDFGGAGAAQQGL    421 - 490
TDSCQSGGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLA    491 - 560
AAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKK    561 - 630
EAAQKVGAVAAATS                                                            631 - 644
//

Text Mined References (37)

PMID Year Title
26005159 2015 Gender-specific association between the cytoplasmic poly(A) binding protein 4 rs4660293 single nucleotide polymorphism and serum lipid levels.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23300856 2012 Depletion of nuclear poly(A) binding protein PABPN1 produces a compensatory response by cytoplasmic PABP4 and PABP5 in cultured human cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22884093 2012 Cytoplasmic poly(A) binding protein 4 is highly expressed in human colorectal cancer and correlates with better prognosis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21940797 2011 Nuclear relocalisation of cytoplasmic poly(A)-binding proteins PABP1 and PABP4 in response to UV irradiation reveals mRNA-dependent export of metazoan PABPs.
More...