Property Summary

NCBI Gene PubMed Count 266
Grant Count 240
R01 Count 173
Funding $14,615,760.54
PubMed Score 470.78
PubTator Score 389.27

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13309 A8K5E0 B4DJT4 Q8TDZ0 Q8TDZ1 Q9BV69
Symbols p45
FBL1
FLB1
FBXL1

Gene

PDB

1LDK   1FQV   1FS1   1FS2   2ASS   2AST  

Gene RIF (226)

PMID Text
26682002 HDACIs effects on Skp2 protein posttranslational modifications and/or on its removal
26573739 Both the F-box domain of Skp2 and Skp1-Skp2 domain motions displaying preferential conformational control can together facilitate polyubiquitination of a wide variety of substrates.
26568291 miR-186 has a suppressive role in esophageal squamous cell carcinoma progression via SKP2-mediated pathway
26429528 Over-expression of Skp2 resulted in the increased cell growth and number of S phase cells in Skp2 transfected MCF-7 cells
26345857 Patients with breast cancer have an increased SKP2 level. Interference in SKP2 gene expression can inhibit breast cancer cell growth.
26320455 High expression of SKP2 is associated with Advanced Ovarian Cancer.
26051179 Data suugest that S-phase kinase-associated protein 2 (Skp2)-mediated Ras-related GTP-binding protein RagA ubiquitination recruits GATOR1 to restrict mTORC1 signaling upon sustained amino acid stimulation.
26046466 Results demonstrate that curcumin exerts its antitumor activity through inhibition of glioma cell Skp2 pathway.
26038816 TRUSS is a novel substrate of E3 ligase Skp2.
25843293 Data identify SKP2 as a direct transcriptional target of MYCN in neuroblastoma cells.
More...

AA Sequence

MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRL      1 - 70
KSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTL     71 - 140
DLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQN    141 - 210
LSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAH    211 - 280
VSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIP    281 - 350
ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK    351 - 420
PSCL                                                                      421 - 424
//

Text Mined References (280)

PMID Year Title
26682002 2016 Histone Deacetylase Inhibitors Increase p27(Kip1) by Affecting Its Ubiquitin-Dependent Degradation through Skp2 Downregulation.
26573739 2016 Molecular dynamics simulations elucidate the mode of protein recognition by Skp1 and the F-box domain in the SCF complex.
26568291 2016 microRNA-186 inhibits cell proliferation and induces apoptosis in human esophageal squamous cell carcinoma by targeting SKP2.
26429528 2015 [Over-expression of human S-phase kinase-associated protein 2 (Skp2) promotes proliferation of MCF-7 breast cancer cells and increases the number of S phase cells].
26345857 2015 S-phase kinase-associated protein 2 expression interference inhibits breast cancer cell proliferation.
26320455 2015 SKP2/P27Kip1 pathway is associated with Advanced Ovarian Cancer in Saudi Patients.
26051179 2015 Skp2-Mediated RagA Ubiquitination Elicits a Negative Feedback to Prevent Amino-Acid-Dependent mTORC1 Hyperactivation by Recruiting GATOR1.
26046466 2015 Curcumin suppresses cell growth and invasion and induces apoptosis by down-regulation of Skp2 pathway in glioma cells.
26038816 2015 The G1 phase E3 ubiquitin ligase TRUSS that gets deregulated in human cancers is a novel substrate of the S-phase E3 ubiquitin ligase Skp2.
25843293 2015 SKP2 is a direct transcriptional target of MYCN and a potential therapeutic target in neuroblastoma.
More...