Property Summary

NCBI Gene PubMed Count 21
Grant Count 7
Funding $976,539.84
PubMed Score 141.77
PubTator Score 82.05

Knowledge Summary

Patent (28,770)

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma multiforme -1.200 0.001
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -2.700 0.000
pilocytic astrocytoma 4.100 0.000
psoriasis -1.200 0.000

Gene RIF (13)

PMID Text
25807830 This review summarizes knowledge about role of GPR17 receptors in physiology and pathology of nervous system, with special attention to remyelination processes.
25624481 GPR17 gene disruption does not alter food intake or glucose homeostasis in mice.
24613411 Low levels of GRK2/GRK5 causes a slow and not complete desensitization/down-regulation of GPR17.
24150254 Data indicate that small molecule MDL29,951 activates human, mouse and rat orphan G protein-coupled receptor GPR17.
23908386 Nucleotides, nucleotide sugars, and cysteinyl leukotrienes do not promote activation of GPR17 in five different cell lines, nor does GPR17 have signaling properties.
23801362 Data validate GPR17 as a target for neurorepair
23288840 analysis of agonist-induced trafficking of native GPR17 in oligodendroglial cells
21531793 A functional cross-talk exists between cysteinyl-leukotriene and purinergic sites at GPR17; the latter have a hierarchy in producing desensitizing signals.
21261596 REVIEW: functional properties and in vivo biology
20148890 We present the first isoform-specific characterization of GPR17 and show that differences exist between the isoforms in expression pattern and pharmacological profile; the two human isoforms might serve tissue-specific functions
More...

AA Sequence

MSKRSWWAGSRKPPREMLKLSGSDSSQSMNGLEVAPPGLITNFSLATAEQCGQETPLENMLFASFYLLDF      1 - 70
ILALVGNTLALWLFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIACRLTGFLFY     71 - 140
LNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWVVVAVAMAPLLVSPQTVQTNHTVVCL    141 - 210
QLYREKASHHALVSLAVAFTFPFITTVTCYLLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYH    211 - 280
VNRSVYVLHYRSHGASCATQRILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPP    281 - 350
SFEGKTNESSLSAKSEL                                                         351 - 367
//

Text Mined References (22)

PMID Year Title
25807830 2014 [Recently identified GPR17 receptors--characteristics and role in pathology of the nervous system].
25624481 2015 GPR17 gene disruption does not alter food intake or glucose homeostasis in mice.
24613411 2014 Does GRK-? arrestin machinery work as a "switch on" for GPR17-mediated activation of intracellular signaling pathways?
24150254 2013 Decoding signaling and function of the orphan G protein-coupled receptor GPR17 with a small-molecule agonist.
23908386 2013 Is GPR17 a P2Y/leukotriene receptor? examination of uracil nucleotides, nucleotide sugars, and cysteinyl leukotrienes as agonists of GPR17.
23801362 2013 Changes of the GPR17 receptor, a new target for neurorepair, in neurons and glial cells in patients with traumatic brain injury.
23288840 2013 The regulated expression, intracellular trafficking, and membrane recycling of the P2Y-like receptor GPR17 in Oli-neu oligodendroglial cells.
21531793 2011 Agonist-induced desensitization/resensitization of human G protein-coupled receptor 17: a functional cross-talk between purinergic and cysteinyl-leukotriene ligands.
21261596 2011 EBI2, GPR18 and GPR17--three structurally related, but biologically distinct 7TM receptors.
20148890 2010 Distinct expression and ligand-binding profiles of two constitutively active GPR17 splice variants.
More...