Property Summary

NCBI Gene PubMed Count 20
Grant Count 7
R01 Count 5
Funding $774,523
PubMed Score 42.12
PubTator Score 24.04

Knowledge Summary

Patent (3,436)

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 2.500 0.000
astrocytoma -1.900 0.000
posterior fossa group A ependymoma -2.700 0.000
glioblastoma -2.600 0.000
oligodendroglioma -2.000 0.000
osteosarcoma -2.421 0.000
medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -2.900 0.000
primitive neuroectodermal tumor -2.700 0.000
non-small cell lung cancer -1.102 0.000
lung cancer -1.200 0.001
interstitial cystitis 1.100 0.013
adult high grade glioma -2.600 0.000
pilocytic astrocytoma -2.500 0.000
Pick disease -1.200 0.016
acute myeloid leukemia 1.200 0.004

Synonym

Accession Q13303 A0AVM9 A8K1A4 B0AZR7 O43659 Q2YD85 Q5TG82 Q5TG83 Q6ZNE4 Q99411
Symbols AKR6A5
KCNA2B
HKvbeta2
KV-BETA-2
HKvbeta2.1
HKvbeta2.2

Gene

PDB

1ZSX  

  TechDev Info (1)

Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available

Gene RIF (2)

PMID Text
23390957 Incretin regulation of beta-cell function involves the acetylation of Kv beta2.
23264583 Results identified gain and loss of function mutations which lead to increased and decreased potassium currents enhancing AF.

AA Sequence

MYPESTTGSPARLSLRQTGSPGMIYSTRYGSPKRQLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAE      1 - 70
QLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGL     71 - 140
KASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPP    141 - 210
ICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSE    211 - 280
EGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHE    281 - 350
IDSILGNKPYSKKDYRS                                                         351 - 367
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23390957 2013 Incretin-stimulated interaction between ?-cell Kv1.5 and Kv?2 channel proteins involves acetylation/deacetylation by CBP/SirT1.
23264583 2013 Genetic variation in KCNA5: impact on the atrial-specific potassium current IKur in patients with lone atrial fibrillation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21357749 2011 Cdk-mediated phosphorylation of the Kv?2 auxiliary subunit regulates Kv1 channel axonal targeting.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...