Property Summary

NCBI Gene PubMed Count 55
Grant Count 1
Funding $54,656.6
PubMed Score 58.22
PubTator Score 35.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -4.200 0.000
cutaneous lupus erythematosus -1.700 0.046
Endometriosis -2.817 0.037
breast carcinoma -1.500 0.001
Breast cancer -3.700 0.001

Synonym

Accession Q13296 A1A522 Q86WH8
Symbols MGB1
UGB2

Gene

 Grant Application (1)

 Compartment GO Term (0)

Gene RIF (43)

PMID Text
26276775 trefoil factor 1 demonstrated breast specificity but was inferior to mammaglobin and GATA protein binding 3
24603286 The data indicate that MGB1, MGB2 and LIPB mRNAs are expressed at low levels in human tissues but basal expression is upregulated in ovarian cancer.
24328556 Overexpression of hMAM in breast cancer cells decreased migration and invasion, whereas knockdown of hMAM increased both.
23958549 Mammaglobin-A immunohistochemistry in primary central nervous system neoplasms and intracranial metastatic breast carcinoma. Cimino PJ Jr, Perrin RJ
23773480 Mammaglobin immunohistochemistry is useful as a proxy marker for the ETV6-NTRK3 translocation in the diagnosis of salivary mammary analogue secretory carcinoma.
23212340 Qualitative detection of plasma hMAM mRNA appears to be associated with unfavorable prognostic factors and lower rates of event-free survival in patients with breast cancer.
22994369 MGB1 was detected in endometrial tissue, with peak expression during the luteal phase, in 31% of endometriotic samples, in 53% of endometrial adenocarcinomas, and in 64% of breast carcinomas.
22963676 Gross cystic disease fluid protein-15 and mammaglobin A expression determined by immunohistochemistry is of limited utility in triple-negative breast cancer.
22897908 High peripheral blood mammaglobin gene expression is associated with metastasis in breast cancer.
22074997 Data show that HLA-A24-restricted, mammaglobin-A (Mam-A) derived, CD8(+) cytotoxic T lymphocyte (CTL) epitopes that can potentially be employed for Mam-A-based breast cancer vaccine therapy to breast cancer patients with HLA-A24 phenotype.
More...

AA Sequence

MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQT      1 - 70
DETLSNVEVFMQLIYDSSLCDLF                                                    71 - 93
//

Text Mined References (55)

PMID Year Title
26276775 2015 Evaluating the utility of trefoil factor 1 as a mammary-specific immunostain compared and in conjunction with GATA-3 and mammaglobin in the distinction between carcinoma of breast and lung.
25416956 2014 A proteome-scale map of the human interactome network.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24603286 2014 Differential expression of secretoglobins in normal ovary and in ovarian carcinoma--overexpression of mammaglobin-1 is linked to tumor progression.
24328556 2014 Upregulation of human mammaglobin reduces migration and invasion of breast cancer cells.
23958549 2014 Mammaglobin-A immunohistochemistry in primary central nervous system neoplasms and intracranial metastatic breast carcinoma.
23773480 2013 Utility of mammaglobin immunohistochemistry as a proxy marker for the ETV6-NTRK3 translocation in the diagnosis of salivary mammary analogue secretory carcinoma.
23212340 2012 Plasma human mammaglobin mRNA associated with poor outcome in patients with breast cancer.
22994369 2012 Mammaglobin 1: not only a breast-specific and tumour-specific marker, but also a hormone-responsive endometrial protein.
22963676 2013 Gross cystic disease fluid protein-15 and mammaglobin A expression determined by immunohistochemistry is of limited utility in triple-negative breast cancer.
More...