Property Summary

NCBI Gene PubMed Count 59
PubMed Score 58.96
PubTator Score 35.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.4e-05
breast carcinoma 1638 6.3e-04
Breast cancer 3578 1.3e-03
Endometriosis 540 3.7e-02
cutaneous lupus erythematosus 1057 4.6e-02
Disease Target Count Z-score Confidence
3-methylglutaconic aciduria type 1 7 3.085 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -3.700 1.3e-03
breast carcinoma -1.500 6.3e-04
cutaneous lupus erythematosus -1.700 4.6e-02
Endometriosis -2.817 3.7e-02
psoriasis -1.900 1.4e-05

Gene RIF (47)

AA Sequence

MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQT      1 - 70
DETLSNVEVFMQLIYDSSLCDLF                                                    71 - 93
//

Text Mined References (59)

PMID Year Title