Property Summary

NCBI Gene PubMed Count 71
Grant Count 269
R01 Count 102
Funding $34,017,204.91
PubMed Score 641.53
PubTator Score 337.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 2.800 0.001
osteosarcoma -3.507 0.000
Atopic dermatitis 1.100 0.000
interstitial cystitis 2.300 0.002
primary Sjogren syndrome 1.600 0.000
ulcerative colitis 1.600 0.000
psoriasis 1.500 0.000

Synonym

Accession Q13291 Q5W172 Q9HBE8 W0HKK7
Symbols SLAM
CD150
CDw150

Gene

PDB

1M27   1D4T   1D4W   1KA6   1KA7   1I3Z   2DZF   2IE9   2IFL   2IG5  

Gene RIF (43)

PMID Text
26619119 results indicate that loss of SLAMF1 expression in chronic lymphocytic leukemia modulates genetic pathways
25920347 Data suggest that SLAMF1 is another significant piece in the intricate defective immune-regulatory function of patients with SLE.
25716736 Upstream open reading frames regulate translation of the long isoform of SLAMF1 mRNA that encodes costimulatory receptor CD150
24770789 Molecular dynamics analysis revealed that mutant R32Q and T53I structures of SAP exhibited structural variation with respect to their backbone atoms before and after binding with the unphosphorylated SLAM peptide.
24373350 Signaling lymphocytic activation molecule (SLAM)/SLAM-associated protein pathway regulates human B-cell tolerance.
24238277 Latent membrane protein 1 was responsible for the CD150 upregulation.
23554862 Experimental adaptation of wild-type canine distemper virus (CDV) to the human entry receptor CD150
22532682 HIV-1 infection induces a high level of SLAM expression on CD4(+) T cells, which may enhance their susceptibility to measles virus and exacerbate measles in coinfected individuals.
22493499 conclude that Slamf1 recruits a subset of Vps34-associated proteins, which is involved in membrane fusion and NOX2 regulation
22277902 the study demonstrates that variants of SLAMF1 and ITLN1, both implicated in inflammation, are associated with type 2 diabetes in Indians.
More...

AA Sequence

MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSL      1 - 70
ENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQ     71 - 140
VSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICT    141 - 210
VSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTI    211 - 280
YAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES                   281 - 335
//

Text Mined References (76)

PMID Year Title
26619119 2016 SLAMF1 regulation of chemotaxis and autophagy determines CLL patient response.
25920347 2015 Analysis of expression and function of the co-stimulatory receptor SLAMF1 in immune cells from patients with systemic lupus erythematosus (SLE).
25716736 2014 Upstream open reading frames regulate translation of the long isoform of SLAMF1 mRNA that encodes costimulatory receptor CD150.
25710480 2015 Expression of CD150 in tumors of the central nervous system: identification of a novel isoform.
24770789 2014 Structural characterization of disease-causing mutations on SAP and the functional impact on the SLAM peptide: a molecular dynamics approach.
24373350 2014 Signaling lymphocytic activation molecule (SLAM)/SLAM-associated protein pathway regulates human B-cell tolerance.
24238277 2014 Enhanced susceptibility of B lymphoma cells to measles virus by Epstein-Barr virus type III latency that upregulates CD150/signaling lymphocytic activation molecule.
23554862 2013 Experimental adaptation of wild-type canine distemper virus (CDV) to the human entry receptor CD150.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22532682 2012 HIV-1 infection ex vivo accelerates measles virus infection by upregulating signaling lymphocytic activation molecule (SLAM) in CD4+ T cells.
More...