Property Summary

NCBI Gene PubMed Count 44
PubMed Score 13.94
PubTator Score 19.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 1.274 3.6e-03
adult high grade glioma 1.800 2.1e-04
astrocytoma 1.100 3.1e-08
Astrocytoma, Pilocytic 2.200 1.3e-09
cutaneous lupus erythematosus 2.000 2.3e-05
dermatomyositis 2.300 4.7e-03
ependymoma 1.900 4.0e-12
esophageal adenocarcinoma 1.300 3.4e-02
glioblastoma 2.100 1.0e-07
intraductal papillary-mucinous carcinoma... 1.100 3.1e-02
juvenile dermatomyositis 2.712 1.1e-16
lung cancer -1.900 6.8e-04
lung carcinoma -2.000 8.9e-22
medulloblastoma, large-cell -1.200 5.8e-03
Multiple Sclerosis 1.200 3.1e-03
ovarian cancer 2.500 1.4e-05
pancreatic cancer 1.100 1.4e-05
primary Sjogren syndrome 1.200 2.1e-02
psoriasis 1.300 1.7e-08
subependymal giant cell astrocytoma 2.210 3.3e-02
Waldenstrons macroglobulinemia 1.628 1.5e-02

Synonym

Accession Q13287 B5BU69 Q53TI8 Q8WTW2 Q9BVE5 Nmi
Symbols

Gene

NMI

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (24)

AA Sequence

MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMK      1 - 70
FLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPV     71 - 140
PLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEI    141 - 210
GVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHF    211 - 280
QRAKNGGGEVDVVKCSLGQPHIAYFEE                                               281 - 307
//

Text Mined References (47)

PMID Year Title