Property Summary

NCBI Gene PubMed Count 90
PubMed Score 937.33
PubTator Score 251.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Disease Target Count Z-score Confidence
Batten disease 13 0.0 5.0

Expression

 GO Function (1)

Pathway (1)

Gene RIF (54)

AA Sequence

MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWLLGLCNNFSYVVMLSAAHDILSHKRTSG      1 - 70
NQSHVDPGPTPIPHNSSSRFDCNSVSTAAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGICAAGSFV     71 - 140
LVAFSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAVISWWSSGTGGAGLLGALSYLGLTQAGLSPQ    141 - 210
QTLLSMLGIPALLLASYFLLLTSPEAQDPGGEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWTVFKG    211 - 280
LLWYIVPLVVVYFAEYFINQGLFELLFFWNTSLSHAQQYRWYQMLYQAGVFASRSSLRCCRIRFTWALAL    281 - 350
LQCLNLVFLLADVWFGFLPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGI    351 - 420
SLSGLLALPLHDFLCQLS                                                        421 - 438
//

Text Mined References (97)

PMID Year Title