Property Summary

Ligand Count 6
NCBI Gene PubMed Count 212
PubMed Score 877.01
PubTator Score 465.08

Knowledge Summary

Patent (63,724)

TINX Plot

  Disease (5)

Disease Target Count
Cryptorchidism 296
Male infertility 206
46,XY Sex Reversal 3 1
Abnormal sex determination 11
Abnormality of the labia 9
Abnormality of the scrotum 9
Adrenal gland hypofunction 9
Ambiguous Genitalia 24
Aplasia/Hypoplasia of the breasts 10
Aplasia/hypoplasia of the uterus 4
Autosomal recessive predisposition 1442
Azoospermia 110
Congenital hypoplasia of penis 176
Decreased fertility 33
Decreased fertility in females 20
Decreased testosterone in males 28
Delayed Puberty 97
Delayed bone age 136
Elevated follicle stimulating hormone 15
Elevated gonadotropins 15
Elevated luteinizing hormone 14
Female external genitalia in males 13
Generalized osteopenia 99
Gonadal Dysgenesis 28
Gonadal Dysgenesis, Mixed 19
Gynecomastia 64
Hypertrophy of clitoris 40
Hypogonadism, Isolated Hypogonadotropic 71
Hypogonadotropic hypogonadism 89
Hypoplasia of vagina 14
Low serum estradiol levels 22
Male Pseudohermaphroditism 19
Non-obstructive azoospermia 21
Obstructive azoospermia 5
Osteopenia 99
Osteoporosis 363
Osteoporosis of vertebrae 5
Ovarian Failure, Premature 9
PREMATURE OVARIAN FAILURE 7 (disorder) 1
Penile hypospadias 106
Polycystic ovary syndrome 360
Premature Menopause 31
Primary hypogonadism 37
Primary physiologic amenorrhea 55
Pure Gonadal Dysgenesis, 46, XX 5
Pure gonadal dysgenesis 19
Rudimentary vagina 14
Sclerocystic Ovaries 17
Sex reversal 10
Small testicle 75
Sparse axillary hair 28
Sparse pubic hair 31
Streak ovary 15
Streaky metaphyseal sclerosis 2
Swyer Syndrome 8
Testicular dysgenesis 9
Testicular regression syndrome 9
Urogenital sinus anomaly 15
ovarian neoplasm 99
Disease Target Count P-value
psoriasis 6694 1.6e-04

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 1.6e-04

 GWAS Trait (1)

Gene RIF (168)

AA Sequence

MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRF      1 - 70
QKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKLETGPPMGVPPPPPPAPDYVL     71 - 140
PPSLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLP    141 - 210
YGYPEPFSGGPNVPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWA    211 - 280
RRCMVFKELEVADQMTLLQNCWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLR    281 - 350
AQELVLQLLALQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLL    351 - 420
LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT                                 421 - 461
//

Text Mined References (219)

PMID Year Title