Property Summary

NCBI Gene PubMed Count 70
Grant Count 39
R01 Count 34
Funding $2,680,075.89
PubMed Score 103.61
PubTator Score 80.03

Knowledge Summary

Patent

No data available

Expression

Gene RIF (47)

PMID Text
27022092 G3BP mediates the condensation of stress granules by shifting between two different states that are controlled by the phosphorylation of S149 and by binding to Caprin1 or USP10.
26432022 Host G3BP1 captures HIV-1 RNA transcripts and thereby restricts mRNA translation, viral protein production and virus particle formation.
26350772 G3BP1 granules were assembled independently of TIA-1 and had a negative impact on Dengue virus replication.
25962958 Our findings identified a novel function of G3BP1 in the progression of breast cancer via activation of the epithelial-to-mesenchymal transition
25847539 G3BP1 is essential for normal stress granule-processing body interactions and stress granule function.
25809930 Our data define G3BP1 as a novel independent prognostic factor that is correlated with gastric cancer progression.
25800057 these findings demonstrate a critical role for YB-1 in stress granule formation through translational activation of G3BP1, and highlight novel functions for stress granules in tumor progression.
25784705 The G3BP1-Caprin1-PKR complex represents a new mode of PKR activation and is important for antiviral activity of G3BP1 and PKR during infection with mengovirus.
25658430 ICP8 binding to G3BP also inhibits SG formation, which is a novel function of HSV ICP8.
25653451 Stress granule components G3BP1 and G3BP2 play a proviral role early in Chikungunya virus replication.
More...

AA Sequence

MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNF      1 - 70
TNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGG     71 - 140
FVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEI    141 - 210
QEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPAS    211 - 280
QPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHE    281 - 350
VDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAARE    351 - 420
GDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ                            421 - 466
//

Text Mined References (91)

PMID Year Title
27022092 2016 G3BP-Caprin1-USP10 complexes mediate stress granule condensation and associate with 40S subunits.
26432022 2015 G3BP1 restricts HIV-1 replication in macrophages and T-cells by sequestering viral RNA.
26350772 2015 Dengue virus infection induces formation of G3BP1 granules in human lung epithelial cells.
25962958 2015 Involvement of Ras GTPase-activating protein SH3 domain-binding protein 1 in the epithelial-to-mesenchymal transition-induced metastasis of breast cancer cells via the Smad signaling pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25847539 2015 G3BP1 promotes stress-induced RNA granule interactions to preserve polyadenylated mRNA.
25809930 2015 Overexpression of Ras-GTPase-activating protein SH3 domain-binding protein 1 correlates with poor prognosis in gastric cancer patients.
25800057 2015 YB-1 regulates stress granule formation and tumor progression by translationally activating G3BP1.
25784705 2015 Stress granules regulate double-stranded RNA-dependent protein kinase activation through a complex containing G3BP1 and Caprin1.
25658430 2015 Viral and cellular proteins containing FGDF motifs bind G3BP to block stress granule formation.
More...