Property Summary

NCBI Gene PubMed Count 78
PubMed Score 111.40
PubTator Score 80.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.587 2.5e-08
astrocytoma 1.400 4.2e-03
atypical teratoid / rhabdoid tumor 1.200 4.5e-07
Breast cancer 3.300 3.7e-02
gastric cancer 1.300 8.1e-03
glioblastoma 1.200 1.5e-03
hepatocellular carcinoma 1.500 3.1e-05
intraductal papillary-mucinous adenoma (... 1.100 1.5e-02
intraductal papillary-mucinous carcinoma... 1.200 6.6e-03
lung adenocarcinoma 1.186 6.6e-06
medulloblastoma 1.100 1.2e-05
medulloblastoma, large-cell 1.900 8.7e-06
osteosarcoma 1.375 3.1e-04
ovarian cancer -1.100 1.0e-04
pancreatic cancer 1.100 2.6e-02
pancreatic carcinoma 1.100 2.6e-02
primary Sjogren syndrome 1.100 5.7e-03
psoriasis 1.100 2.0e-06
tuberculosis and treatment for 3 months -1.400 2.1e-03
ulcerative colitis -1.243 3.7e-02
Waldenstrons macroglobulinemia 1.221 4.1e-03

Gene RIF (53)

AA Sequence

MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNF      1 - 70
TNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGG     71 - 140
FVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEI    141 - 210
QEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPAS    211 - 280
QPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHE    281 - 350
VDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAARE    351 - 420
GDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ                            421 - 466
//

Text Mined References (100)

PMID Year Title