Knowledge Summary

Patent

No data available

Synonym

Accession Q13278
Symbols

Gene

RIG

 Compartment GO Term (0)

AA Sequence

MPFFSSCLCPSHYSGPSLPSSTSSSLPTGPENQLGFVLLQAMVHHANSSCVRNAFWLQITEKLTPALSII      1 - 70
ISVVYLRCPEMVENRIGFLLNVKDSKTLSVVGPHPKPCIL                                   71 - 110
//

Text Mined References (1)

PMID Year Title
9070656 1997 Identification of a novel gene product, RIG, that is down-regulated in human glioblastoma.