Property Summary

NCBI Gene PubMed Count 40
Grant Count 21
R01 Count 19
Funding $2,371,432.24
PubMed Score 53.66
PubTator Score 46.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
psoriasis 1.200 0.001
osteosarcoma -2.533 0.000
medulloblastoma, large-cell 2.400 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.010
group 3 medulloblastoma 2.500 0.000
spina bifida -1.572 0.022
Pick disease -1.100 0.000
ductal carcinoma in situ 1.300 0.000
invasive ductal carcinoma 1.900 0.000
ulcerative colitis -1.700 0.000
pituitary cancer 1.700 0.002
axial spondyloarthropathy 1.100 0.046

Gene RIF (17)

PMID Text
26553929 GLUT5 required an interaction cascade of Rab11, Myo5B, Slp4a, Munc18-2, and Vamp7 with Stx3.
25673875 Rab11a-knockdown cells displayed mislocalization of STX3 and the presentation of microvilli in the basolateral compartment
25630102 The results showed that there was reduction in aggregation propensity of syntaxin-3 with point mutation at Val286.
25583387 hcmv-miR-US33-5p-mediated inhibition of HCMV DNA synthesis and of viral replication are specifically mediated by down-regulation of STX3 expression.
25548252 the secretion of IL-1alpha, IL-1beta, IL-12b, and CCL4 occurs during gelatinase degranulation, a process controlled by STX3.
25358429 we report for the first time a missense mutation of a novel lens specific gene STX3 in a phenotype associating autosomal recessive congenital cataract and intellectual disability.
24726755 loss of STX3 function causes variant microvillus inclusion disease
24171760 syntaxin3 has a latent prosurvival function and is involved in maintenance of homeostasis in epidermal keratinocytes
23132338 In insulin secretion, SYN-3 plays a role in the mediation of newcomer SG exocytosis and SG-SG fusion that contributes to biphasic GSIS.
21981832 STX-3 and SNAP-23 are crucial for the release of all chemokines in mature human mast cells
More...

AA Sequence

MKDRLEQLKAKQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPE      1 - 70
PKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVD     71 - 140
FRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKDIVRLESSIKE    141 - 210
LHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKARDETKKAVKYQSQARKKLIIIIVLVVVLLGILAL    211 - 280
IIGLSVGLN                                                                 281 - 289
//

Text Mined References (43)

PMID Year Title
26553929 2015 Cargo-selective apical exocytosis in epithelial cells is conducted by Myo5B, Slp4a, Vamp7, and Syntaxin 3.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25673875 2015 Rab11a regulates syntaxin 3 localization and microvillus assembly in enterocytes.
25630102 2014 Effect of mutation on aggregation propensity in homology model structures of syntaxin-3 from Homo sapiens.
25583387 2015 Human cytomegalovirus miR-US33-5p inhibits viral DNA synthesis and viral replication by down-regulating expression of the host Syntaxin3.
25548252 2015 An essential role of syntaxin 3 protein for granule exocytosis and secretion of IL-1?, IL-1?, IL-12b, and CCL4 from differentiated HL-60 cells.
25416956 2014 A proteome-scale map of the human interactome network.
25358429 2015 Autosomal recessive congenital cataract, intellectual disability phenotype linked to STX3 in a consanguineous Tunisian family.
24726755 2014 Loss of syntaxin 3 causes variant microvillus inclusion disease.
24171760 2013 Effluent syntaxin3 from dying cells affords protection against apoptosis in epidermal keratinocytes.
More...