Property Summary

NCBI Gene PubMed Count 40
PubMed Score 58.85
PubTator Score 46.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
axial spondyloarthropathy 1.100 4.6e-02
ductal carcinoma in situ 1.300 4.8e-04
group 3 medulloblastoma 1.900 1.7e-05
intraductal papillary-mucinous neoplasm ... 1.100 9.6e-03
invasive ductal carcinoma 1.900 1.1e-04
malignant mesothelioma 1.900 8.3e-08
medulloblastoma, large-cell 1.800 7.3e-06
osteosarcoma -1.298 4.0e-03
Pick disease -1.100 2.8e-05
pituitary cancer 1.400 1.9e-05
psoriasis 1.200 6.3e-04
spina bifida -1.572 2.2e-02
ulcerative colitis -1.200 4.7e-05

Gene RIF (17)

AA Sequence

MKDRLEQLKAKQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPE      1 - 70
PKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVD     71 - 140
FRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKDIVRLESSIKE    141 - 210
LHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKARDETKKAVKYQSQARKKLIIIIVLVVVLLGILAL    211 - 280
IIGLSVGLN                                                                 281 - 289
//

Text Mined References (43)

PMID Year Title