Property Summary

NCBI Gene PubMed Count 18
PubMed Score 33.86
PubTator Score 63.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma 1.150 4.3e-02
breast carcinoma 1.300 6.7e-04
cystic fibrosis -1.468 1.9e-03
interstitial cystitis -3.500 4.4e-02
intraductal papillary-mucinous adenoma (... -2.300 1.3e-02
lung cancer 2.700 2.3e-05
non-small cell lung cancer 1.067 3.2e-03
pancreatic cancer -1.200 4.2e-02
pancreatic ductal adenocarcinoma liver m... -1.105 2.7e-02
psoriasis -3.000 1.5e-33

Gene RIF (10)

AA Sequence

MLSAVARGYQGWFHPCARLSVRMSSTGIDRKGVLANRVAVVTGSTSGIGFAIARRLARDGAHVVISSRKQ      1 - 70
QNVDRAMAKLQGEGLSVAGIVCHVGKAEDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDK     71 - 140
ILSVNVKSPALLLSQLLPYMENRRGAVILVSSIAAYNPVVALGVYNVSKTALLGLTRTLALELAPKDIRV    141 - 210
NCVVPGIIKTDFSKVFHGNESLWKNFKEHHQLQRIGESEDCAGIVSFLCSPDASYVNGENIAVAGYSTRL    211 - 280
//

Text Mined References (21)

PMID Year Title