Property Summary

NCBI Gene PubMed Count 18
Grant Count 5
R01 Count 5
Funding $309,972.2
PubMed Score 32.98
PubTator Score 63.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cystic fibrosis 2.100 0.000
adrenocortical carcinoma 2.513 0.009
pancreatic ductal adenocarcinoma liver m... -1.105 0.027
non-small cell lung cancer 1.067 0.003
intraductal papillary-mucinous adenoma (... -2.300 0.013
lung cancer 2.700 0.000
pancreatic cancer -1.200 0.042
interstitial cystitis -5.900 0.001
breast carcinoma 1.300 0.001
psoriasis -3.000 0.000

Synonym

Accession Q13268 D3DS54 Q53GS4 Q7Z789 Q9H2R2
Symbols HEP27
SDR25C1

Gene

PANTHER Protein Class (2)

Gene RIF (10)

PMID Text
23036705 DHRS2 and DHRS4 genes are syntenic outparalogues originating from a duplication of the DHRS4 gene that took place before the formation of the mammalian clade
23036705 A rapid divergent evolution brought the human DHRS2 gene, duplicated form of the DHRS4 one, to code a SDR enzyme having subcellular localization, synthesis regulation and specialized cellular functions very different from those of the human DHRS4 enzyme.
20949095 c-Myb proto-oncogene has a tumor suppressor role in breast cancer via c-Myb controlled DHRS2 (HEP27) expression.
20547751 Hep27 is regulated at the transcriptional level by the proto-oncogene c-Myb and is required for c-Myb-induced p53 stabilization.
19443906 In human endometrial carcinoma cells, the Hep27 protein encoded by DHRS2 is specifically upregulated in mitochondria by the ERM/ETV5 transcription factor and Hep27 has a protective role against apoptosis induced by oxidative stress.
16685466 Hep27 is a NADPH-dependent dicarbonyl reductase enzyme active on xenobiotics.
11997086 Molecular cloning, sequence and Chr 14 localization of the DHRS2 gene. Nuclear and cytoplasmic localization and normal tissue distribution of the DHRS2-encoded Hep27 protein.
11944995 Complete genomic organization of DHRS2, including two alternative promoter regions: a hepatocyte-specific promoter and a monocyte-derived dendritic cell-specific promoter
7556196 Hep27 a cell-cycle regulated protein belongs to the SDR family (short-chain dehydrogenase/reductase family).
1847869 The synthesis of the nuclear protein D (Hep27 protein old name) is up-regulated in growth-inhibited HepG2 cells and is inhibited during DNA synthesis.

AA Sequence

MLSAVARGYQGWFHPCARLSVRMSSTGIDRKGVLANRVAVVTGSTSGIGFAIARRLARDGAHVVISSRKQ      1 - 70
QNVDRAMAKLQGEGLSVAGIVCHVGKAEDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDK     71 - 140
ILSVNVKSPALLLSQLLPYMENRRGAVILVSSIAAYNPVVALGVYNVSKTALLGLTRTLALELAPKDIRV    141 - 210
NCVVPGIIKTDFSKVFHGNESLWKNFKEHHQLQRIGESEDCAGIVSFLCSPDASYVNGENIAVAGYSTRL    211 - 280
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23036705 2012 Molecular and functional evolution of human DHRS2 and DHRS4 duplicated genes.
21269460 2011 Initial characterization of the human central proteome.
20949095 2010 Potential tumor suppressor role for the c-Myb oncogene in luminal breast cancer.
20547751 2010 Mitochondrial Hep27 is a c-Myb target gene that inhibits Mdm2 and stabilizes p53.
19443906 2009 Proteomic approach to ETV5 during endometrial carcinoma invasion reveals a link to oxidative stress.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...