Property Summary

NCBI Gene PubMed Count 86
Grant Count 35
R01 Count 14
Funding $3,375,985
PubMed Score 11.81
PubTator Score 88.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 2.700 0.000
cutaneous lupus erythematosus 1.200 0.001
osteosarcoma -1.805 0.000
lung cancer -1.700 0.000
interstitial cystitis 1.800 0.000
ulcerative colitis 1.200 0.000

Gene RIF (72)

PMID Text
26719339 The novel mechanism of IL-15 transfer to the surface of antigen-processing DCs may explain the enhanced potency of IL-15:IL-15Ralpha-coated nanoparticles for antigen delivery.
26675759 Report improved antitumoral NK-cell activity in DC-based vaccine strategies through the use of IL-15/IL-15Ralpha mRNA-engineered designer DC.
25964490 IRF-1 promotes LTx I/R injury via hepatocyte IL-15/IL-15Ralpha production and suggest that targeting IRF-1 and IL-15/IL-15Ralpha may be effective in reducing I/R injury associated with LTx.
25879761 Report Il15Ralpha levels in synovial fluid from rheumatoid arthritis patients.
25412359 NK cell activation in human hantavirus infection explained by virus-induced IL-15/IL15Ralpha expression
25387549 significant association of rs2228059 with ossification of the posterior longitudinal ligament of the spine in Chinese Han population
24980552 Coexpression of IL15RA and IL15 was also sufficient to activate peripheral blood mononuclear cells.
24912180 Data suggest that the Interleukin (IL)-15 and interleukin 15 receptor alpha (IL-15.IL-15Ralpha) complex cleaved from presenting cells allows responding cells to internalize, store and use IL-15.IL-15Ralpha complex for their own proliferation and survival.
24696261 This present study demonstrated that IL15RA rs2228059 A > C polymorphism might modify Gastric cardiac adenocarcinoma susceptibility
24603895 Circulating levels of IL-15 and IL-15Ralpha seem to reflect visceral distribution of adipose tissue; epicardial fat may be a potential source of both IL-15 and IL-15Ralpha.
More...

AA Sequence

MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTS      1 - 70
SLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTA     71 - 140
ATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVAIST    141 - 210
STVLLCGLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL                 211 - 267
//

Text Mined References (89)

PMID Year Title
26719339 2016 Configuration-dependent Presentation of Multivalent IL-15:IL-15R? Enhances the Antigen-specific T Cell Response and Anti-tumor Immunity.
26675759 2015 Transpresentation of interleukin-15 by IL-15/IL-15R? mRNA-engineered human dendritic cells boosts antitumoral natural killer cell activity.
25964490 2015 IRF-1 promotes liver transplant ischemia/reperfusion injury via hepatocyte IL-15/IL-15R? production.
25879761 2015 Differential expression of pro-inflammatory cytokines IL-15Ralpha, IL-15, IL-6 and TNFalpha in synovial fluid from rheumatoid arthritis patients.
25412359 2014 NK cell activation in human hantavirus infection explained by virus-induced IL-15/IL15R? expression.
25387549 2014 Association between single nucleotide polymorphism of IL15RA gene with susceptibility to ossification of the posterior longitudinal ligament of the spine.
24980552 2014 IL15RA drives antagonistic mechanisms of cancer development and immune control in lymphocyte-enriched triple-negative breast cancers.
24912180 2014 IL-15.IL-15R? complex shedding following trans-presentation is essential for the survival of IL-15 responding NK and T cells.
24696261 2014 Interleukin 15 receptor alpha rs2228059 A > C polymorphism decreased risk of gastric cardiac adenocarcinoma in a Chinese population.
24603895 2014 Interleukin-15 and soluble interleukin-15 receptor ? in coronary artery disease patients: association with epicardial fat and indices of adipose tissue distribution.
More...