Property Summary

Ligand Count 216
NCBI Gene PubMed Count 72
PubMed Score 541.17
PubTator Score 409.72

Knowledge Summary

Patent (58,835)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
ASTHMA-RELATED TRAITS, SUSCEPTIBILITY TO, 1 1 0.0 0.0
Disease Target Count
Dyslipidemia 2
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Asthma 385 4.158 2.1

Expression

  Differential Expression (9)

Disease log2 FC p
active ulcerative colitis -1.767 1.7e-02
colon cancer -2.900 2.1e-02
Crohn's disease -1.078 1.1e-03
lung cancer -1.500 2.5e-04
lung carcinoma -1.500 2.5e-18
osteosarcoma -2.761 1.6e-06
ovarian cancer -3.800 5.4e-23
posterior fossa group B ependymoma 1.500 1.1e-03
tuberculosis 1.800 3.6e-03

Gene RIF (61)

AA Sequence

MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSVFYMLVCGLTV      1 - 70
TDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSSTLQLLAMALECWLSLGHPFFY     71 - 140
RRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPGTWCFIQMVHEEGSLSVLGYSVLYSSLMALL    141 - 210
VLATVLCNLGAMRNLYAMHRRLQRHPRSCTRDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLP    211 - 280
VIYRAYYGAFKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCS    281 - 350
NSTNMESSL                                                                 351 - 359
//

Text Mined References (75)

PMID Year Title