Property Summary

NCBI Gene PubMed Count 69
Grant Count 28
R01 Count 4
Funding $2,185,643.67
PubMed Score 509.59
PubTator Score 409.72

Knowledge Summary

Patent (58,835)

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -2.761 0.000
Crohn's disease -1.078 0.001
active ulcerative colitis -2.093 0.041
tuberculosis 1.800 0.004
colon cancer -2.900 0.021
lung cancer -1.500 0.000
posterior fossa group B ependymoma 1.500 0.001
lung carcinoma -1.500 0.000
ovarian cancer -3.800 0.000

Gene RIF (58)

PMID Text
26792210 PGD2 markedly augments disease activity through its ability to enhance the proinflammatory actions of macrophages and subsequent neutrophil activation.
25681680 EP2 receptors exhibit more constraints to mutations than DP receptors.
25142778 Non-obligatory role of prostaglandin D2 receptor subtype 1 in rosacea: laropiprant in comparison to a placebo did not alleviate the symptoms of erythematoelangiectaic rosacea
24922638 Low DP1 prostanoid receptor is associated with gastric cancer progression.
24493589 Lipocalin-type prostaglandin D2 (PGD2) synthase (L-PGDS) interacts intracellularly with the G protein-coupled receptor DP1 in an agonist-independent manner.
23307871 PGD(2)-DP signaling reduces vascular permeability via endothelial cAMP/PKA/Tiam1/Rac1 pathway.
23192614 the PTGDR -549 C/T polymorphism confers susceptibility to asthma in Europeans and adults. However, no association was found between the PTGDR 441 C/T and -197 C/T polymorphisms or the CCC and TCT haplotypes and asthma susceptibility.
23181793 Genetic variant may play a role in NSAID induced acute urticaria.
22182808 The PTGDR -441C/T polymorphism is not associated with asthma or its phenotypes in the North Indian population.
21930295 DP receptors amplify the biological response to CRTH2 activation and the CRTH2/DP heteromer might represent both a functional signaling unit for PGD(2) and a potential target for development of heteromer-directed therapy for allergic diseases
More...

AA Sequence

MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSVFYMLVCGLTV      1 - 70
TDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSSTLQLLAMALECWLSLGHPFFY     71 - 140
RRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPGTWCFIQMVHEEGSLSVLGYSVLYSSLMALL    141 - 210
VLATVLCNLGAMRNLYAMHRRLQRHPRSCTRDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLP    211 - 280
VIYRAYYGAFKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCS    281 - 350
NSTNMESSL                                                                 351 - 359
//

Text Mined References (72)

PMID Year Title
26792210 2016 Activated prostaglandin D2 receptors on macrophages enhance neutrophil recruitment into the lung.
25681680 2015 Human EP2 prostanoid receptors exhibit more constraints to mutations than human DP prostanoid receptors.
25142778 2015 Non-obligatory role of prostaglandin D2 receptor subtype 1 in rosacea: laropiprant in comparison to a placebo did not alleviate the symptoms of erythematoelangiectaic rosacea.
24922638 2014 The role of type D prostanoid receptors and PPAR? in gastric cancer progression.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24493589 2014 A G protein-coupled receptor and the intracellular synthase of its agonist functionally cooperate.
24045676 2014 Genome-wide association studies and epistasis analyses of candidate genes related to age at menarche and age at natural menopause in a Korean population.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23307871 2013 Prostaglandin D2-DP signaling promotes endothelial barrier function via the cAMP/PKA/Tiam1/Rac1 pathway.
23192614 2013 PTGDR polymorphisms and susceptibility to asthma: a meta-analysis.
More...