Property Summary

NCBI Gene PubMed Count 161
PubMed Score 26.92
PubTator Score 285.24

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13257 Q53F56 Q548X9 Q6IRW7 Q8IZX3 HsMAD2
Symbols MAD2
HSMAD2

Gene

PDB

1GO4   5LCW   2QYF   1DUJ   1KLQ   1S2H   2V64   2VFX   3GMH  

Gene RIF (110)

PMID Text
26544187 p31comet-induced cell death is mediated by interactions with Mad2
26489879 Studied the folding/unfolding process of the open and closed conformers of human Mad2.
26305957 Data indicate the structure of the intermediate conformer of the multistate checkpoint protein mitotic arrest deficient 2 (Mad2) protein.
26287798 MAD2L1 and BUB1 may play important roles in breast cancer progression, and measuring the expression of these genes may assist the prediction of breast cancer prognosis.
26183163 MAD1L1 Arg558His and MAD2L1 Leu84Met interaction with smoking increase the risk of colorectal cancer
25898113 We also show that replication perturbations result in relocalization of MAD1/MAD2 in human cells, suggesting that the role of SAC in DNA repair is conserved.
25637637 CDC20, MAD2 and Aurora-B protein expression are associated with chromosomal abnormalities and poor prognosis in patients with myelodysplastic syndromes.
25503128 MAD2 may be involved in oral carcinogenesis and may represent an important prognostic factor associated with a more malignant phenotype of oral squamous cell carcinoma.
25483095 In conclusion, the results presented here suggest that Mad2 and BubR1 could be used as prognostic markers of tumor progression and new pharmacological targets in the treatment for gastric cancer .
25422469 the interaction of FAT10 with MAD2 is a key mechanism underlying the promalignant property of FAT10
More...

AA Sequence

MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVE      1 - 70
QLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVT     71 - 140
FLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND         141 - 205
//

Text Mined References (170)

PMID Year Title
26544187 2015 p31comet-Induced Cell Death Is Mediated by Binding and Inactivation of Mad2.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26489879 2016 Stable folding intermediates prevent fast interconversion between the closed and open states of Mad2 through its denatured state.
26305957 2015 Structure of an intermediate conformer of the spindle checkpoint protein Mad2.
26287798 2015 Biological and Clinical Significance of MAD2L1 and BUB1, Genes Frequently Appearing in Expression Signatures for Breast Cancer Prognosis.
26183163 2015 MAD1L1 Arg558His and MAD2L1 Leu84Met interaction with smoking increase the risk of colorectal cancer.
25898113 2015 DNA damage response and spindle assembly checkpoint function throughout the cell cycle to ensure genomic integrity.
25637637 2015 Proteins of the mitotic checkpoint and spindle are related to chromosomal instability and unfavourable prognosis in patients with myelodysplastic syndrome.
25503128 2014 MAD2 expression in oral squamous cell carcinoma and its relationship to tumor grade and proliferation.
25483095 2014 Mad2 and BubR1 modulates tumourigenesis and paclitaxel response in MKN45 gastric cancer cells.
More...