Property Summary

NCBI Gene PubMed Count 182
PubMed Score 30.58
PubTator Score 285.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 1.333 5.3e-03
adrenocortical carcinoma 3.055 5.5e-09
adult high grade glioma 2.000 4.4e-03
Atopic dermatitis 1.300 1.7e-03
atypical teratoid / rhabdoid tumor 1.700 8.8e-06
Breast cancer 2.500 3.1e-02
breast carcinoma 2.000 2.5e-31
colon cancer 1.900 6.5e-07
ductal carcinoma in situ 2.600 2.0e-03
Endometriosis 1.873 2.1e-02
ependymoma 1.100 5.8e-04
glioblastoma 2.500 8.2e-09
group 3 medulloblastoma 2.900 1.1e-04
intraductal papillary-mucinous carcinoma... 2.900 1.4e-04
intraductal papillary-mucinous neoplasm ... 3.600 5.4e-04
invasive ductal carcinoma 3.300 3.0e-04
lung adenocarcinoma 1.604 6.7e-04
lung cancer 4.400 3.2e-06
medulloblastoma, large-cell 3.400 9.5e-08
nasopharyngeal carcinoma 2.100 6.6e-07
non-small cell lung cancer 3.582 2.3e-36
ovarian cancer 2.000 1.2e-03
pancreatic cancer 1.800 5.3e-06
pituitary cancer 2.200 1.5e-06
primary Sjogren syndrome 1.400 6.9e-03
primitive neuroectodermal tumor 2.600 2.4e-05
psoriasis 1.200 1.3e-02

Protein-protein Interaction (1)

PDB (10)

Gene RIF (119)

AA Sequence

MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVE      1 - 70
QLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVT     71 - 140
FLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND         141 - 205
//

Text Mined References (191)

PMID Year Title