Property Summary

NCBI Gene PubMed Count 104
Grant Count 287
R01 Count 201
Funding $31,658,109.29
PubMed Score 1071.73
PubTator Score 94.06

Knowledge Summary

Patent (17,320)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -2.000 0.000
ependymoma -3.300 0.001
oligodendroglioma -2.800 0.007
glioblastoma -3.900 0.000
sonic hedgehog group medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -3.700 0.000
primitive neuroectodermal tumor -2.900 0.001
pediatric high grade glioma -3.300 0.000
pilocytic astrocytoma -3.700 0.000
subependymal giant cell astrocytoma -4.066 0.005
Pick disease -1.200 0.034
pituitary cancer 1.300 0.035
psoriasis -1.400 0.000

Synonym

Accession Q13255 B9EG79 F8W805 Q13256 Q14757 Q14758 Q5VTF7 Q5VTF8 Q9NU10 Q9UGS9 Q9UGT0 mGluR1
Symbols MGLU1
GPRC1A
MGLUR1
SCAR13
PPP1R85

Gene

PANTHER Protein Class (2)

PDB

3KS9   4OR2  

  TechDev Info (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
743429 confirmatory 0 / 0 / 1 Selectivity Studies of mglur8 probe at mglur1

Gene RIF (78)

PMID Text
26308914 a missense variant was found in GRM1 gene, while in the second family, a frameshift alteration was identified in TRMT1, both of which were found to co-segregate with the intellectual disability.
26291396 These data demonstrate that the approaches commonly used to study mGlu1 receptor function and signaling in other systems may be inappropriate for studying mGlu1 receptor-mediated melanoma cell viability.
26154847 It has the intrinsic ability to form a heteromeric complex with adenosine A1 receptor and mutually modulate signaling.
25944910 alpha-actinin-4 is a novel group 1 mGluR-interacting partner that orchestrates spine dynamics and morphogenesis in neurons.
25859923 Our results are likely relevant to human breast cancer, highlighting a putative role of mGluR1 in the pathophysiology of breast cancer and the potential of mGluR1 as a novel therapeutic target.
25299066 elevated glutamate secretion and mGluR1 expression play a role in Kaposi's sarcoma associated herpesvirus induced cell proliferation
25137254 Deleterious GRM1 mutations are associated with schizophrenia.
25062106 These novel mutations may contribute to the disease by alterations in GRM1 gene splicing, receptor activation, and post-receptor downstream signaling.
25057192 In mice expressing mutant beta-III spectrin, mGluR1 localization is altered at Purkinje cell dendritic spines.
25003238 reflected in the immunoblotting data Mglur1 receptors were detected at higher levels of expression in patient with cortical dysplasia with intractable epilepsy.
More...

AA Sequence

MVGLLLFFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEI      1 - 70
REQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGINRC     71 - 140
LPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTL    141 - 210
QARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRER    211 - 280
LPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSF    281 - 350
DDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAM    351 - 420
AHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQYTEAN    421 - 490
RYDYVHVGTWHEGVLNIDDYKIQMNKSGVVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEYVQDEF    491 - 560
TCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSREL    561 - 630
CYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRF    631 - 700
MSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYY    701 - 770
AFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA    771 - 840
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGAGNANSNGKSVSWSEPGGGQVPKGQHMW    841 - 910
HRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEEEDAQPIRFSPPGSPSMVVHR    911 - 980
RVPSAATTPPLPSHLTAEETPLFLAEPALPKGLPPPLQQQQQPPPQQKSLMDQLQGVVSNFSTAIPDFHA    981 - 1050
VLAGPGGPGNGLRSLYPPPPPPQHLQMLPLQLSTFGEELVSPPADDDDDSERFKLLQEYVYEHEREGNTE   1051 - 1120
EDELEEEEEDLQAASKLTPDDSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVSYASVILRDYKQS   1121 - 1190
SSTL                                                                     1191 - 1194
//

Text Mined References (106)

PMID Year Title
26308914 2015 The Role of a Novel TRMT1 Gene Mutation and Rare GRM1 Gene Defect in Intellectual Disability in Two Azeri Families.
26291396 2015 Atypical signaling of metabotropic glutamate receptor 1 in human melanoma cells.
26154847 2015 Complex formation and functional interaction between adenosine A1 receptor and type-1 metabotropic glutamate receptor.
25944910 2015 Actinin-4 Governs Dendritic Spine Dynamics and Promotes Their Remodeling by Metabotropic Glutamate Receptors.
25859923 2015 Metabotropic glutamate receptor 1 disrupts mammary acinar architecture and initiates malignant transformation of mammary epithelial cells.
25299066 2014 Glutamate secretion and metabotropic glutamate receptor 1 expression during Kaposi's sarcoma-associated herpesvirus infection promotes cell proliferation.
25137254 2014 Chemical modulation of mutant mGlu1 receptors derived from deleterious GRM1 mutations found in schizophrenics.
25062106 2014 Identification of novel GRM1 mutations and single nucleotide polymorphisms in prostate cancer cell lines and tissues.
25057192 2014 Mutant ?-III spectrin causes mGluR1? mislocalization and functional deficits in a mouse model of spinocerebellar ataxia type 5.
25003238 2014 Expression of astrocyte-related receptors in cortical dysplasia with intractable epilepsy.
More...