Property Summary

Ligand Count 95
NCBI Gene PubMed Count 107
PubMed Score 1115.63
PubTator Score 94.06

Knowledge Summary

Patent (17,320)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Kidney cancer 2613 0.0 0.9
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 4.067 2.0

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.800 1.4e-04
astrocytic glioma -1.800 1.1e-02
Astrocytoma, Pilocytic -3.700 1.6e-09
atypical teratoid / rhabdoid tumor -3.800 2.1e-06
ependymoma -3.300 7.8e-04
glioblastoma -3.300 7.8e-10
medulloblastoma -1.700 1.7e-02
medulloblastoma, large-cell -3.700 5.6e-05
oligodendroglioma -2.800 7.0e-03
Pick disease -1.200 3.4e-02
pituitary cancer 1.300 3.5e-02
primitive neuroectodermal tumor -2.900 9.4e-04
psoriasis -1.400 2.1e-16
subependymal giant cell astrocytoma -4.066 5.2e-03

Gene RIF (81)

AA Sequence

MVGLLLFFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEI      1 - 70
REQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGINRC     71 - 140
LPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTL    141 - 210
QARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRER    211 - 280
LPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSF    281 - 350
DDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAM    351 - 420
AHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQYTEAN    421 - 490
RYDYVHVGTWHEGVLNIDDYKIQMNKSGVVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEYVQDEF    491 - 560
TCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSREL    561 - 630
CYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRF    631 - 700
MSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYY    701 - 770
AFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA    771 - 840
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGAGNANSNGKSVSWSEPGGGQVPKGQHMW    841 - 910
HRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEEEDAQPIRFSPPGSPSMVVHR    911 - 980
RVPSAATTPPLPSHLTAEETPLFLAEPALPKGLPPPLQQQQQPPPQQKSLMDQLQGVVSNFSTAIPDFHA    981 - 1050
VLAGPGGPGNGLRSLYPPPPPPQHLQMLPLQLSTFGEELVSPPADDDDDSERFKLLQEYVYEHEREGNTE   1051 - 1120
EDELEEEEEDLQAASKLTPDDSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVSYASVILRDYKQS   1121 - 1190
SSTL                                                                     1191 - 1194
//

Text Mined References (109)

PMID Year Title