Property Summary

NCBI Gene PubMed Count 88
Grant Count 431
R01 Count 236
Funding $50,679,962.65
PubMed Score 783.11
PubTator Score 295.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
oligodendroglioma 1.400 0.000
osteosarcoma -2.161 0.000
medulloblastoma -2.000 0.015
medulloblastoma, large-cell -2.200 0.004
adult high grade glioma -1.100 0.026
atypical teratoid/rhabdoid tumor 1.500 0.004
sarcoidosis -2.100 0.000
mucosa-associated lymphoid tissue lympho... -1.205 0.021

Synonym

Accession Q13253
Symbols SYM1
SYNS1
SYNS1A

Gene

NOG

PANTHER Protein Class (1)

PDB

1M4U  

Gene RIF (56)

PMID Text
26413886 An imbalance between BMP-2 and Noggin secretion induces abnormal osteogenic differentiation of ankylosing spondylitis-mesenchymal stem cells.
26383864 early noggin exposure may play a specific role in the directed differentiation of DA cells from human embryonic stem cells.
25888563 Novel p.W150C NOG mutation associated with proximal symphalangism and conductive hearing impairment was identified in a Chinese family.Impaired dimerization of mutant NOG is an important pathogenic mechanism for the NOG-related disorder.
25391606 By next-generation and Sanger sequencing analyses, study identified two novel mutations, c.559C>G (p.P178A) and c.682T>A (p.C228S), in the proximal symphalangism and atypical multiple synostosis syndrome families, respectively.
25339627 No association between SPRY2, single-nucleotide polymorphisms, and nonsyndromic cleft lip with or without cleft palate risk were observed in this cohort of patients.
24735539 this study proposes that the decreased binding affinity of NOG with the p.R136C mutation to HSPG leads to an excess of bone morphogenetic protein signaling and underlies the proximal symphalangism and conductive hearing loss phenotype of carriers.
24706492 The study did not provide support for NOG being the causal gene at 17q22 in nonsyndromic cleft lip with or without cleft palate.
24326127 a novel NOG mutation in a Chinese family with proximal symphalangism
24170657 High-quality studies show that otosclerosis in Japanese patients is not linked to the NOG gene. [Review]
23826422 Even though gremlin 1 and noggin were not widely expressed in adult tissues, in a subset of organs their expression pattern indicated a potential role in normal tissue homeostasis as well as in malignancies.
More...

AA Sequence

MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLL      1 - 70
GGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKK     71 - 140
LRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRR    141 - 210
GGQRCGWIPIQYPIISECKCSC                                                    211 - 232
//

Text Mined References (91)

PMID Year Title
26643732 2016 A New Subtype of Multiple Synostoses Syndrome Is Caused by a Mutation in GDF6 That Decreases Its Sensitivity to Noggin and Enhances Its Potency as a BMP Signal.
26413886 2016 Imbalance Between Bone Morphogenetic Protein 2 and Noggin Induces Abnormal Osteogenic Differentiation of Mesenchymal Stem Cells in Ankylosing Spondylitis.
26383864 2015 Noggin Over-Expressing Mouse Embryonic Fibroblasts and MS5 Stromal Cells Enhance Directed Differentiation of Dopaminergic Neurons from Human Embryonic Stem Cells.
25888563 2015 A Novel Missense Mutation of NOG Interferes With the Dimerization of NOG and Causes Proximal Symphalangism Syndrome in a Chinese Family.
25391606 2015 Identification of two novel mutations in the NOG gene associated with congenital stapes ankylosis and symphalangism.
25339627 2015 Association between NOGGIN and SPRY2 polymorphisms and nonsyndromic cleft lip with or without cleft palate.
24735539 2014 A mutation in the heparin-binding site of noggin as a novel mechanism of proximal symphalangism and conductive hearing loss.
24706492 2014 Nonsyndromic cleft lip with or without cleft palate: Increased burden of rare variants within Gremlin-1, a component of the bone morphogenetic protein 4 pathway.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24326127 2014 Identification of a novel NOG mutation in a Chinese family with proximal symphalangism.
More...