Property Summary

NCBI Gene PubMed Count 35
PubMed Score 31.65
PubTator Score 33.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Alzheimer's disease -1.300 4.1e-02
Breast cancer -1.200 1.7e-12
colon cancer -1.200 2.0e-02
ependymoma 1.200 1.9e-02
intraductal papillary-mucinous carcinoma... 1.200 1.0e-02
Multiple myeloma 1.035 7.4e-03
non-small cell lung cancer -1.037 3.2e-24
osteosarcoma -1.270 7.5e-04
ovarian cancer -1.700 3.2e-07
pancreatic cancer -1.900 4.4e-02
pancreatic carcinoma -1.900 4.4e-02
Pick disease -2.000 5.5e-05
progressive supranuclear palsy -1.700 4.8e-03
tuberculosis and treatment for 6 months 1.200 2.3e-04
Waldenstrons macroglobulinemia 1.344 6.3e-04

Gene RIF (19)

AA Sequence

MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIE      1 - 70
HARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAH     71 - 140
RPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIEGSKRHSRSRSRSRSRTRSSSRSRSRSRSRSRK    141 - 210
SYSRSRSRSRSRSRSKSRSVSRSPVPEKSQKRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN            211 - 272
//

Text Mined References (44)

PMID Year Title