Property Summary

NCBI Gene PubMed Count 31
Grant Count 18
R01 Count 13
Funding $1,335,459.21
PubMed Score 30.05
PubTator Score 33.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer -1.900 0.044
Waldenstrons macroglobulinemia 1.344 0.001
Multiple myeloma 1.035 0.007
ependymoma 1.200 0.019
osteosarcoma 2.438 0.000
tuberculosis and treatment for 6 months 1.200 0.000
non-small cell lung cancer -1.037 0.000
intraductal papillary-mucinous carcinoma... 1.400 0.012
colon cancer -1.200 0.020
pancreatic carcinoma -1.900 0.044
inflammatory breast cancer -1.400 0.000
Alzheimer's disease -1.700 0.025
Pick disease -2.700 0.000
progressive supranuclear palsy -2.300 0.004
ovarian cancer 2.600 0.000

Gene RIF (19)

PMID Text
25665148 Suggest that SRp40 might be associated with GRalpha transcripts in systemic lupus erythematosus patients.
22933280 The bidirectional SF2/ASF- and SRp40-dependent splicing enhancer regulates HIV-1 rev, env, vpu, and nef gene expression
22933280 The bidirectional SF2/ASF- and SRp40-dependent splicing enhancer regulates HIV-1 rev, env, vpu, and nef gene expression
22205602 Relative levels of SRp20, SRp30c, and SRp40 in TM cells control differential expression of the two alternatively spliced isoforms of the GR and thereby regulate GC responsiveness.
22100336 We show that changes in alternative splicing of hnRNP A/B, affected by up regulation of SRSF5 (SRp40) or by treatment with C6-ceramide, occur within supraspliceosomes.
20427542 Here, the authors report that specific SR proteins, particularly SRp40 and SRp55, promote human immunodeficiency virus type 1 (HIV-1) Gag translation from unspliced (intron-containing) viral RNA.
20427542 The bidirectional SF2/ASF- and SRp40-dependent splicing enhancer regulates HIV-1 rev, env, vpu, and nef gene expression
20376328 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19843576 SRp40 antagonizes ASF/SF2 and SRp55 by competing for binding to certain sites in exon 5, thereby promoting TF exon 5 exclusion, an event unique to asTF biosynthesis.
19004959 The bidirectional SF2/ASF- and SRp40-dependent splicing enhancer regulates HIV-1 rev, env, vpu, and nef gene expression
More...

AA Sequence

MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIE      1 - 70
HARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAH     71 - 140
RPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIEGSKRHSRSRSRSRSRTRSSSRSRSRSRSRSRK    141 - 210
SYSRSRSRSRSRSRSKSRSVSRSPVPEKSQKRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN            211 - 272
//

Text Mined References (40)

PMID Year Title
25665148 Expression of glucocorticoid receptor isoforms and associations with serine/arginine-rich protein 30c and 40 in patients with systemic lupus erythematosus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22205602 2012 Spliceosome protein (SRp) regulation of glucocorticoid receptor isoforms and glucocorticoid response in human trabecular meshwork cells.
22100336 2012 Regulation of alternative splicing within the supraspliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20516191 2010 A rational nomenclature for serine/arginine-rich protein splicing factors (SR proteins).
More...