Property Summary

NCBI Gene PubMed Count 31
PubMed Score 30.05
PubTator Score 33.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 3.17015156351605E-24
ovarian cancer 8492 3.58882736086962E-8
osteosarcoma 7933 8.35674828187636E-6
Pick disease 1893 1.88839081433047E-5
tuberculosis and treatment for 6 months 686 2.30180660544305E-4
inflammatory breast cancer 404 3.90967198292895E-4
Waldenstrons macroglobulinemia 765 6.25494744043371E-4
progressive supranuclear palsy 674 0.00367222568265501
Multiple myeloma 1328 0.00735343338621305
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0117862995697064
ependymoma 2514 0.0189348870562974
colon cancer 1475 0.0196956478024366
Alzheimer's disease 644 0.0247759549066125
pancreatic cancer 2300 0.0440128530292702
pancreatic carcinoma 567 0.0440128530292705
Disease Target Count Z-score Confidence
Pyruvate decarboxylase deficiency 15 3.476 1.7

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer -1.900 0.044
Waldenstrons macroglobulinemia 1.344 0.001
Multiple myeloma 1.035 0.007
ependymoma 1.200 0.019
osteosarcoma 2.438 0.000
tuberculosis and treatment for 6 months 1.200 0.000
non-small cell lung cancer -1.037 0.000
intraductal papillary-mucinous carcinoma... 1.400 0.012
colon cancer -1.200 0.020
pancreatic carcinoma -1.900 0.044
inflammatory breast cancer -1.400 0.000
Alzheimer's disease -1.700 0.025
Pick disease -2.700 0.000
progressive supranuclear palsy -2.300 0.004
ovarian cancer 2.600 0.000

Synonym

Accession Q13243 O14797 Q16662 Q49AD6 Q6FGE0
Symbols HRS
SFRS5
SRP40

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (15)

PMID Text
25665148 Suggest that SRp40 might be associated with GRalpha transcripts in systemic lupus erythematosus patients.
22933280 The bidirectional SF2/ASF- and SRp40-dependent splicing enhancer regulates HIV-1 rev, env, vpu, and nef gene expression
22205602 Relative levels of SRp20, SRp30c, and SRp40 in TM cells control differential expression of the two alternatively spliced isoforms of the GR and thereby regulate GC responsiveness.
22100336 We show that changes in alternative splicing of hnRNP A/B, affected by up regulation of SRSF5 (SRp40) or by treatment with C6-ceramide, occur within supraspliceosomes.
20427542 Here, the authors report that specific SR proteins, particularly SRp40 and SRp55, promote human immunodeficiency virus type 1 (HIV-1) Gag translation from unspliced (intron-containing) viral RNA.
20427542 The bidirectional SF2/ASF- and SRp40-dependent splicing enhancer regulates HIV-1 rev, env, vpu, and nef gene expression
20376328 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19843576 SRp40 antagonizes ASF/SF2 and SRp55 by competing for binding to certain sites in exon 5, thereby promoting TF exon 5 exclusion, an event unique to asTF biosynthesis.
19004959 The bidirectional SF2/ASF- and SRp40-dependent splicing enhancer regulates HIV-1 rev, env, vpu, and nef gene expression
16990281 SC35, SRp40, and heterogeneous nuclear ribonucleoprotein A1 interact competitively at the HIV-1 Tat exon 2 splicing site
More...

AA Sequence

MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIE      1 - 70
HARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAH     71 - 140
RPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIEGSKRHSRSRSRSRSRTRSSSRSRSRSRSRSRK    141 - 210
SYSRSRSRSRSRSRSKSRSVSRSPVPEKSQKRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN            211 - 272
//

Text Mined References (40)

PMID Year Title
25665148 Expression of glucocorticoid receptor isoforms and associations with serine/arginine-rich protein 30c and 40 in patients with systemic lupus erythematosus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22205602 2012 Spliceosome protein (SRp) regulation of glucocorticoid receptor isoforms and glucocorticoid response in human trabecular meshwork cells.
22100336 2012 Regulation of alternative splicing within the supraspliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20516191 2010 A rational nomenclature for serine/arginine-rich protein splicing factors (SR proteins).
More...