Property Summary

NCBI Gene PubMed Count 40
PubMed Score 15.60
PubTator Score 25.97

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 8.0e-07
diabetes mellitus -1.200 7.8e-03
lung adenocarcinoma 1.222 6.1e-08
lung cancer 1.200 2.3e-04
Multiple myeloma 1.056 2.1e-03
non primary Sjogren syndrome sicca 1.400 4.2e-02
ovarian cancer 1.100 6.4e-03
sonic hedgehog group medulloblastoma 1.100 8.4e-05
Waldenstrons macroglobulinemia 1.198 1.9e-03

 GO Component (2)

Gene RIF (15)

AA Sequence

MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIY      1 - 70
GRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYA     71 - 140
DVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRG    141 - 210
SPHYFSPFRPY                                                               211 - 221
//

Text Mined References (50)

PMID Year Title