Property Summary

NCBI Gene PubMed Count 68
Grant Count 196
R01 Count 117
Funding $27,057,226.47
PubMed Score 404.51
PubTator Score 225.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 2.900 0.001
osteosarcoma -1.749 0.003
medulloblastoma, large-cell 1.100 0.000
non-small cell lung cancer -1.218 0.000
lung cancer -2.400 0.002
lung adenocarcinoma -1.400 0.000
group 4 medulloblastoma 1.300 0.000
lung carcinoma -1.800 0.000
pituitary cancer -3.400 0.000
type I diabetes mellitus -1.249 0.010

Synonym

Accession Q13241 O43321 O43773 Q9UBE3 Q9UEQ0
Symbols CD94

Gene

PDB

3CDG   3CII   3BDW   1B6E  

Gene RIF (44)

PMID Text
26453750 Coengagement of inhibitory receptors, either KIR2DL1 or CD94-NKG2A, did not inhibit phosphorylation of Stat5 but inhibited selectively phosphorylation of Akt and S6 ribosomal protein.
26453102 CD94 and NKG2A polymorphisms may contribute to genetic susceptibility to rheumatoid arthritis or affect the response to anti-TNF therapy in patients of Caucasian origin.
24975965 it is not clear if high expression of CD94 on peripheral blood NK cells is related to abnormal activity of endometrial NK cells.
24935923 Data indicate that NKG2 receptor NKG2E was capable of associating with CD94 and DAP12 but that the complex was retained intracellularly at the endoplasmic reticulum.
24673109 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
24177169 Data indicate that the expression of KLRD1 (CD94) and NKG2E (KLRC3) was reduced in NK-enriched cells in fulminant type 1 diabetes.
24082146 Synergistic inhibition of natural killer cells by the nonsignaling molecule CD94.
24030638 NKG2C zygosity influences CD94/NKG2C receptor function and the NK-cell compartment redistribution in response to human cytomegalovirus.
22576308 Studies indicate that HLA-E interacts with CD94/NKG2 receptors expressed mainly on the surface of natural killer (NK) cells, thus confining its role to the regulation of NK-cell function.
22486170 Results suggested that the low expression level of CD94/NKG2A upon gammadelta T cell activation might lead to the over-activation of gammadelta T cells in patients with SLE.
More...

AA Sequence

MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRC      1 - 70
NCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYL     71 - 140
FPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI                                   141 - 179
//

Text Mined References (69)

PMID Year Title
26453750 2015 NK Cell Proliferation Induced by IL-15 Transpresentation Is Negatively Regulated by Inhibitory Receptors.
26453102 2016 Influence of CD94 and NKG2A variants on susceptibility to rheumatoid arthritis and efficacy of anti-TNF treatment.
25631937 2015 Human CD8 T lymphocytes recognize Mycobacterium tuberculosis antigens presented by HLA-E during active tuberculosis and express type 2 cytokines.
24975965 2014 Increase of CD69, CD161 and CD94 on NK cells in women with recurrent spontaneous abortion and in vitro fertilization failure.
24935923 2014 Human NKG2E is expressed and forms an intracytoplasmic complex with CD94 and DAP12.
24673109 2014 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
24177169 Low gene expression levels of activating receptors of natural killer cells (NKG2E and CD94) in patients with fulminant type 1 diabetes.
24082146 2013 Synergistic inhibition of natural killer cells by the nonsignaling molecule CD94.
24030638 2013 NKG2C zygosity influences CD94/NKG2C receptor function and the NK-cell compartment redistribution in response to human cytomegalovirus.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
More...