Property Summary

NCBI Gene PubMed Count 69
PubMed Score 419.15
PubTator Score 225.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 2.900 1.3e-03
group 4 medulloblastoma 1.300 5.6e-05
lung adenocarcinoma -1.400 4.9e-11
lung cancer -2.400 2.1e-03
lung carcinoma -1.800 2.3e-13
medulloblastoma, large-cell 1.100 4.2e-04
non-small cell lung cancer -1.218 5.5e-13
osteosarcoma -1.749 3.4e-03
pituitary cancer -2.800 4.7e-08
type I diabetes mellitus -1.249 1.0e-02

Gene RIF (46)

AA Sequence

MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRC      1 - 70
NCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYL     71 - 140
FPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI                                   141 - 179
//

Text Mined References (70)

PMID Year Title