Property Summary

NCBI Gene PubMed Count 28
PubMed Score 36.35
PubTator Score 610.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia -2.700 1.6e-02
adrenocortical carcinoma -1.682 1.7e-03
adult high grade glioma 1.300 8.4e-04
cutaneous lupus erythematosus 1.300 9.2e-03
glioblastoma 1.700 6.4e-04
interstitial cystitis 1.900 6.2e-03
intraductal papillary-mucinous adenoma (... -1.100 8.1e-03
intraductal papillary-mucinous carcinoma... -1.700 2.9e-04
intraductal papillary-mucinous neoplasm ... -1.300 1.4e-02
invasive ductal carcinoma 1.978 1.5e-04
lung adenocarcinoma -1.800 1.2e-12
lung cancer -1.300 1.8e-03
lung carcinoma -2.600 1.2e-23
malignant mesothelioma -1.300 3.9e-05
non-small cell lung cancer -1.506 3.3e-17
osteosarcoma -2.089 3.9e-03
primary Sjogren syndrome 2.000 4.0e-04
psoriasis 1.200 9.3e-03
spina bifida 1.231 1.4e-02
subependymal giant cell astrocytoma 1.469 1.0e-02
ulcerative colitis 1.700 1.0e-05

Gene RIF (8)

AA Sequence

MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRES      1 - 70
YIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNN     71 - 140
WYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQED    141 - 210
PEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED        211 - 276
//

Text Mined References (33)

PMID Year Title