Property Summary

NCBI Gene PubMed Count 27
Grant Count 61
R01 Count 46
Funding $6,370,423.61
PubMed Score 36.10
PubTator Score 610.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
25800872 results suggest that cytoplasm-specific transduction of the SH3 and SH2 domains of SLAP has a therapeutic potential of being an immunosuppressive reagent for the treatment of various autoimmune diseases
24284075 Taken together the data demonstrate that SLAP negatively regulates wild-type c-Kit signaling, but not its oncogenic counterpart, indicating a possible mechanism by which the oncogenic c-Kit bypasses the normal cellular negative feedback control
23300935 upon ligand stimulation SLAP stably associates with Flt3 through multiple phosphotyrosine residues in Flt3. SLAP mRNA is differentially expressed in different cancers and its expression significantly increased in patients carrying the Flt3-ITD mutation
22798681 These data provide evidence for src-like adaptor protein-dependent regulation of CD3 zeta-chain in the fine control of TCR signaling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19631983 Although SLA is a prominent glucocorticoids response gene, it does not seem to contribute to the anti-leukemic effects of glucocorticoids.
19240061 Observational study of gene-disease association. (HuGE Navigator)
16521218 The SLA molecule and its functionally relevant residues have been highly conserved throughout the evolution.

AA Sequence

MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRES      1 - 70
YIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNN     71 - 140
WYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQED    141 - 210
PEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED        211 - 276
//

Text Mined References (32)

PMID Year Title
25800872 2015 Intracellular cytoplasm-specific delivery of SH3 and SH2 domains of SLAP inhibits TcR-mediated signaling.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24284075 2014 Src-like-adaptor protein (SLAP) differentially regulates normal and oncogenic c-Kit signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23612905 2013 Robust evidence for five new Graves' disease risk loci from a staged genome-wide association analysis.
23300935 2012 Src-Like adaptor protein (SLAP) binds to the receptor tyrosine kinase Flt3 and modulates receptor stability and downstream signaling.
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
22798681 2012 CD3?-chain expression of human T lymphocytes is regulated by TNF via Src-like adaptor protein-dependent proteasomal degradation.
22561518 2012 Genome-wide association analyses identify 13 new susceptibility loci for generalized vitiligo.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...