Property Summary

NCBI Gene PubMed Count 42
Grant Count 13
R01 Count 6
Funding $1,269,419.8
PubMed Score 53.32
PubTator Score 37.00

Knowledge Summary

Patent (12,897)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
medulloblastoma, large-cell 2.200 0.000
lung adenocarcinoma -1.900 0.000
lung carcinoma -1.200 0.000
acute myeloid leukemia -4.300 0.046
ulcerative colitis -1.400 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (24)

PMID Text
26769964 The C-terminal cyclic nucleotide binding (CNB-B) domain of cGMP-dependent protein kinase II binds cGMP with higher affinity and selectivity when compared with its N-terminal CNB (CNB-A) domain.
26676300 PKG II inhibits EGFinduced activation of HER2 through binding with and causing threonine 686 phosphorylation of this oncogenic protein.
25688884 Han Chinese patients with rs10033237 polymorphism of cGKII/PRKG2 gene are more likely to suffer from gout.
25070890 we determined a crystal structure of the PKG II LZ-Rab11b complex. The PKG II LZ domain presents a mostly nonpolar surface onto which Rab11b docks, through van der Waals interactions
24882840 Our replication study suggests that cGKII is not involved in gout susceptibility.
24549567 PKGII inhibits RhoA activity by binding to this small GTPase and causing phosphorylation at its Ser188 site.
24534906 PKG II also inhibits the activation of the EGFR caused by diverse ligands of the receptor.
23404188 These data suggest that increased PKG II activity attenuates bFGFinduced proliferation and migration by inhibiting the MAPK/ERK signaling pathway, whereas PKG I does not
22940826 type II cGMPdependent protein kinase prevented the EGF-induced phosphorylation/activation of ERK and JNK, but not the phosphorylation of p38MAPK induced by EGF.
22791569 Downregulation of PKG2 was associated with malignant and benign breast tumors.
More...

AA Sequence

MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSKQTVAIAELTE      1 - 70
ELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPP     71 - 140
EFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAE    141 - 210
GRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNF    211 - 280
LRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQ    281 - 350
KGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS    351 - 420
MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFAMKCIRKKHIV    421 - 490
DTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACV    491 - 560
TEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFS    561 - 630
VDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKN    631 - 700
GINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF            701 - 762
//

Text Mined References (47)

PMID Year Title
26769964 2016 Structural Basis of Cyclic Nucleotide Selectivity in cGMP-dependent Protein Kinase II.
26676300 2016 Type II cGMP-dependent protein kinase directly inhibits HER2 activation of gastric cancer cells.
25688884 2015 Polymorphism of rs7688672 and rs10033237 in cGKII/PRKG2 and gout susceptibility of Han population in northern China.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
25070890 2014 Crystal structure of the cGMP-dependent protein kinase II leucine zipper and Rab11b protein complex reveals molecular details of G-kinase-specific interactions.
24882840 2014 Common variants of cGKII/PRKG2 are not associated with gout susceptibility.
24549567 2014 Type II cGMP?dependent protein kinase inhibits RhoA activation in gastric cancer cells.
24534906 2014 Type II cGMP-dependent protein kinase inhibits ligand?induced activation of EGFR in gastric cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
More...