Property Summary

Ligand Count 5
NCBI Gene PubMed Count 45
PubMed Score 54.16
PubTator Score 37.00

Knowledge Summary

Patent (12,897)

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -4.300 4.6e-02
lung adenocarcinoma -1.800 3.6e-17
lung carcinoma -1.200 4.6e-08
malignant mesothelioma -1.400 6.0e-05
medulloblastoma, large-cell 2.200 3.9e-04
ulcerative colitis -1.400 3.6e-05

Gene RIF (26)

AA Sequence

MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSKQTVAIAELTE      1 - 70
ELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPP     71 - 140
EFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAE    141 - 210
GRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNF    211 - 280
LRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQ    281 - 350
KGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS    351 - 420
MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFAMKCIRKKHIV    421 - 490
DTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACV    491 - 560
TEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFS    561 - 630
VDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKN    631 - 700
GINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF            701 - 762
//

Text Mined References (50)

PMID Year Title