Property Summary

NCBI Gene PubMed Count 119
Grant Count 222
R01 Count 161
Funding $12,737,844.24
PubMed Score 110.84
PubTator Score 172.34

Knowledge Summary

Patent (30,258)

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.600 0.001
astrocytoma 1.100 0.000
glioblastoma 1.700 0.000
osteosarcoma -1.166 0.004
sonic hedgehog group medulloblastoma 2.300 0.000
cystic fibrosis -1.920 0.000
medulloblastoma, large-cell 1.500 0.000
primitive neuroectodermal tumor 1.400 0.048
juvenile dermatomyositis 1.058 0.000
tuberculosis and treatment for 6 months 1.700 0.000
lung cancer -1.100 0.012
pediatric high grade glioma 1.300 0.001
pilocytic astrocytoma 1.700 0.000
lung carcinoma -1.400 0.000
ovarian cancer -1.300 0.000
Breast cancer -1.300 0.000

Synonym

Accession Q13233
Symbols MEKK
MEKK1
SRXY6
MEKK 1
MAPKKK1

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (84)

PMID Text
26237449 CSN6 positively regulates c-Jun in a MEKK1-dependent manner
26050649 BAALC conferred chemoresistance in acute myeloid leukemia cells by upregulating ATP-binding cassette proteins in an ERK-dependent manner, which can be therapeutically targeted by MEK inhibitor
26019450 MiR-451 inhibited the proliferation of esophageal squamous cell carcinoma cells by targeting CDKN2D and MAP3K1 expression.
26018553 Mekk1 mediates p53 protein stability in the presence of Mdm2 and reduces p53 ubiquitination, suggesting an interference with Mdm2-mediated degradation of p53 by the ubiquitin-proteasome pathway.
25899310 There were 3 specimens with mutations in MAP3K1 (MEKK1), including two truncation mutants, T779fs and T1481fs; T1481fs encoded an unstable and nonfunctional protein when expressed in vitro.
25529635 We propose that the cancer risk alleles act to increase MAP3K1 expression in vivo and might promote breast cancer cell survival.
25352737 Single nucleotide polymorphisms in ALDOB, MAP3K1, and MEF2C are associated with cataract.
24759887 Results demonstrate that MAP3K1 rs889312 is closely correlated with outcome among diffuse-type gastric cancer in a Chinese population.
24595411 The present meta-analysis suggests that MAPKKK1 rs889312-C allele and rs16886165-G allele might be risk factors for breast cancer, especially in Europeans and Asians.
24253898 MAP3K1 protein expression level in breast cancer cells was higher than that in normal mammary gland cells.
More...

AA Sequence

MAAAAGNRASSSGFPGARATSPEAGGGGGALKASSAPAAAAGLLREAGSGGRERADWRRRQLRKVRSVEL      1 - 70
DQLPEQPLFLAASPPASSTSPSPEPADAAGSGTGFQPVAVPPPHGAASRGGAHLTESVAAPDSGASSPAA     71 - 140
AEPGEKRAPAAEPSPAAAPAGREMENKETLKGLHKMDDRPEERMIREKLKATCMPAWKHEWLERRNRRGP    141 - 210
VVVKPIPVKGDGSEMNHLAAESPGEVQASAASPASKGRRSPSPGNSPSGRTVKSESPGVRRKRVSPVPFQ    211 - 280
SGRITPPRRAPSPDGFSPYSPEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCA    281 - 350
RGTFCIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHT    351 - 420
LSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNREPLICPL    421 - 490
CRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTVQQQPLAGSRRNQESNFNLTHYGTQQIPPAYKDLAEPW    491 - 560
IQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANGESTGNSGGSSGSSPSGGATSGSSQTSISGD    561 - 630
VVEACCSVLSMVCADPVYKVYVAALKTLRAMLVYTPCHSLAERIKLQRLLQPVVDTILVKCADANSRTSQ    631 - 700
LSISTLLELCKGQAGELAVGREILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPA    701 - 770
EFYPHIVSTDVSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTTVPHVFSKLLEM    771 - 840
LSVSSSTHFTRMRRRLMAIADEVEIAEAIQLGVEDTLDGQQDSFLQASVPNNYLETTENSSPECTVHLEK    841 - 910
TGKGLCATKLSASSEDISERLASISVGPSSSTTTTTTTTEQPKPMVQTKGRPHSQCLNSSPLSHHSQLMF    911 - 980
PALSTPSSSTPSVPAGTATDVSKHRLQGFIPCRIPSASPQTQRKFSLQFHRNCPENKDSDKLSPVFTQSR    981 - 1050
PLPSSNIHRPKPSRPTPGNTSKQGDPSKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKC   1051 - 1120
RLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALA   1121 - 1190
IAMAMSASQDALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQA   1191 - 1260
QDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYNLFIEWMAGGS   1261 - 1330
VAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGT   1331 - 1400
GAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTA   1401 - 1470
PSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW                               1471 - 1512
//

Text Mined References (128)

PMID Year Title
26237449 2015 CSN6 positively regulates c-Jun in a MEKK1-dependent manner.
26050649 2015 BAALC potentiates oncogenic ERK pathway through interactions with MEKK1 and KLF4.
26019450 2015 MiR-451 inhibits proliferation of esophageal carcinoma cell line EC9706 by targeting CDKN2D and MAP3K1.
26018553 2015 Nuclear Localization Signal and p53 Binding Site in MAP/ERK Kinase Kinase 1 (MEKK1).
25899310 2015 MAP2K1 and MAP3K1 mutations in Langerhans cell histiocytosis.
25529635 2015 Fine-scale mapping of the 5q11.2 breast cancer locus reveals at least three independent risk variants regulating MAP3K1.
25352737 2014 Electronic medical records and genomics (eMERGE) network exploration in cataract: several new potential susceptibility loci.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24759887 2014 A MAP3k1 SNP predicts survival of gastric cancer in a Chinese population.
24595411 2014 Association between mitogen-activated protein kinase kinase kinase 1 polymorphisms and breast cancer susceptibility: a meta-analysis of 20 case-control studies.
More...