Property Summary

NCBI Gene PubMed Count 106
Grant Count 11
R01 Count 2
Funding $1,626,383.16
PubMed Score 356.54
PubTator Score 290.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (101)

PMID Text
26847098 BALF chitotriosidase activity is increased in patients with sarcoidosis.
26624962 study indicates that genotype analysis by HRM-PCR is a fast, reliable, and highly accurate screening approach for identifying the 24-bp duplication in CHIT1 exon 10.
26621384 the presence of product polymers of 40 sugar moieties and higher starts to disappear already at 8% degradation for HCHT50-W31A. Such behavior contrast that of the wild type and HCHT-W218A and resembles the action of endo-nonprocessive chitinases
26422563 No correlation between CHIT1 24-base pair duplication polymorphism and prognosis in sarcoidosis was shown, but possible protective role of homozygous condition for CHIT1 24-base pair duplication polymorphism is suggested.
26372680 Serum CHIT1 rs3831317 and CHI3L1 rs4950928 genotypes were examined in patients with asthma and COPD in a European study to evaluate factors that affect chitinase levels in patients with severe airway disease.
26339162 Our findings indicate that chitotriosidase and S10012A are useful in diagnosis and detection of subclinical inflammation and/or assessment of disease activity in FMF patients.
26332238 study found the 24-bp insertion in the gene for chitotriosidase was associated with the development of mycetoma caused by M. mycetomatis
26143917 The study presents new X-ray data to resolutions of between 0.95 and 1.10 A for CHIT1 in apo and pseudo-apo forms and in complex with chitobiose, an N-acetylglucosamine (NAG) dimer.
26116146 The two Chit1 isoforms combine features of exo-processive and endo-nonprocessive chitinases with the somewhat unusual carbohydrate binding module 14 to reach a high degree of efficiency.
26026464 CHIT-1 is expressed during the process of differentiation and maturation of dendritic cells in a time-dependent manner.
More...

AA Sequence

MVRSVAWAGFMVLLMIPWGSAAKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTE      1 - 70
WNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWE     71 - 140
YPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLM    141 - 210
AYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTR    211 - 280
VGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQK    281 - 350
GLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLPYLPSGTPELEVPKPGQPSEPEHGPSPGQDTFC    351 - 420
QGKADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTWN                            421 - 466
//

Text Mined References (109)

PMID Year Title
26847098 2016 Bronchoalveolar lavage chitotriosidase activity as a biomarker of sarcoidosis.
26624962 2016 Allelic Frequency of a 24-bp Duplication in Exon 10 of the CHIT1 Gene in the General Iranian Population.
26621384 2016 The role of active site aromatic residues in substrate degradation by the human chitotriosidase.
26422563 2015 Common chitotriosidase duplication gene polymorphism and clinical outcome status in sarcoidosis.
26372680 2016 Increased YKL-40 and Chitotriosidase in Asthma and Chronic Obstructive Pulmonary Disease.
26339162 2015 S1000A12, Chitotriosidase, and Resolvin D1 as Potential Biomarkers of Familial Mediterranean Fever.
26332238 2015 A Polymorphism in the Chitotriosidase Gene Associated with Risk of Mycetoma Due to Madurella mycetomatis Mycetoma--A Retrospective Study.
26143917 2015 New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
26116146 2015 The effect of the carbohydrate binding module on substrate degradation by the human chitotriosidase.
26026464 2015 Chitotriosidase Expression during Monocyte-Derived Dendritic Cells Differentiation and Maturation.
More...