Property Summary

NCBI Gene PubMed Count 115
PubMed Score 382.53
PubTator Score 290.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ductal carcinoma in situ 1.600 4.5e-02
head and neck cancer and chronic obstruc... 1.300 3.3e-03
lung adenocarcinoma 1.300 4.5e-04
lung carcinoma -1.100 2.5e-03
mucosa-associated lymphoid tissue lympho... 1.474 5.0e-02
non-small cell lung carcinoma 1.100 6.6e-07
osteosarcoma -2.996 8.2e-05
sarcoidosis 3.300 1.8e-02

 MGI Phenotype (1)

Protein-protein Interaction (3)

PDB (16)

Gene RIF (110)

AA Sequence

MVRSVAWAGFMVLLMIPWGSAAKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTE      1 - 70
WNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWE     71 - 140
YPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLM    141 - 210
AYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTR    211 - 280
VGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQK    281 - 350
GLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLPYLPSGTPELEVPKPGQPSEPEHGPSPGQDTFC    351 - 420
QGKADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTWN                            421 - 466
//

Text Mined References (118)

PMID Year Title