Property Summary

NCBI Gene PubMed Count 52
PubMed Score 274.27
PubTator Score 2990.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
ovarian neoplasm 99
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hypertension 396 5.06 2.5
Obstructive sleep apnea 26 3.05 1.5

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease -1.674 7.2e-03
active ulcerative colitis -1.809 3.5e-03
adrenocortical carcinoma -2.283 2.7e-12
adult high grade glioma -1.300 3.5e-03
astrocytic glioma -2.000 1.0e-02
Astrocytoma, Pilocytic -1.600 8.0e-07
atypical teratoid / rhabdoid tumor -2.600 2.8e-08
colon cancer -2.100 1.5e-02
cutaneous lupus erythematosus -1.100 1.9e-02
cystic fibrosis -1.100 4.0e-04
ependymoma 1.200 6.3e-04
group 3 medulloblastoma -1.700 1.6e-04
intraductal papillary-mucinous adenoma (... 2.200 1.4e-04
intraductal papillary-mucinous neoplasm ... 1.100 6.4e-03
invasive ductal carcinoma -1.484 2.8e-03
lung adenocarcinoma -1.600 9.7e-09
lung cancer -1.700 2.8e-03
lung carcinoma -1.800 2.3e-25
malignant mesothelioma -4.300 3.7e-08
medulloblastoma, large-cell -1.800 1.6e-03
mucosa-associated lymphoid tissue lympho... 2.634 6.4e-03
nasopharyngeal carcinoma -1.800 3.8e-06
non-small cell lung cancer -3.049 5.4e-19
osteosarcoma -3.992 1.9e-05
ovarian cancer -3.000 1.6e-07
pancreatic ductal adenocarcinoma liver m... -1.126 2.1e-02
pituitary cancer -1.400 4.6e-04
psoriasis -1.500 1.7e-08
tuberculosis 1.200 2.8e-02

Protein-protein Interaction (4)

Gene RIF (33)

AA Sequence

MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVDPKSPQYCQVIHRLPMPNLKD      1 - 70
ELHHSGWNTCSSCFGDSTKSRTKLVLPSLISSRIYVVDVGSEPRAPKLHKVIEPKDIHAKCELAFLHTSH     71 - 140
CLASGEVMISSLGDVKGNGKGGFVLLDGETFEVKGTWERPGGAAPLGYDFWYQPRHNVMISTEWAAPNVL    141 - 210
RDGFNPADVEAGLYGSHLYVWDWQRHEIVQTLSLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKN    211 - 280
EGGTWSVEKVIQVPPKKVKGWLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLF    281 - 350
LGGSIVKGGPVQVLEDEELKSQPEPLVVKGKRVAGGPQMIQLSLDGKRLYITTSLYSAWDKQFYPDLIRE    351 - 420
GSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI                      421 - 472
//

Text Mined References (60)

PMID Year Title