Property Summary

NCBI Gene PubMed Count 50
PubMed Score 257.83
PubTator Score 2990.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 2.28193148419842E-25
non-small cell lung cancer 2798 5.39925095702566E-19
adrenocortical carcinoma 1427 2.67952989491428E-12
posterior fossa group A ependymoma 1511 1.74608210769369E-9
ulcerative colitis 2087 9.61699467448645E-9
lung adenocarcinoma 2714 9.69864510829543E-9
psoriasis 6685 1.67973524686397E-8
atypical teratoid / rhabdoid tumor 4369 2.8113610238331E-8
malignant mesothelioma 3163 3.73819540583434E-8
ovarian cancer 8492 1.58616369649789E-7
lung cancer 4473 3.1934599085956E-7
pilocytic astrocytoma 3086 1.13168597948984E-6
nasopharyngeal carcinoma 1056 3.78122785304621E-6
group 4 medulloblastoma 1875 9.14253489220061E-6
osteosarcoma 7933 1.85013578897164E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.37854487294094E-4
cystic fibrosis 1670 4.03119675222041E-4
pituitary cancer 1972 4.6056367201943E-4
medulloblastoma, large-cell 6234 0.00158327279041554
invasive ductal carcinoma 2950 0.00279220965162119
adult high grade glioma 2148 0.00352012549140296
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00643291381528985
mucosa-associated lymphoid tissue lymphoma 480 0.0064478865626482
active Crohn's disease 918 0.00719133063949863
astrocytic glioma 2241 0.0104006061562661
colon cancer 1475 0.0153006454911559
cutaneous lupus erythematosus 1056 0.0187376432321593
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0211266780803029
tuberculosis 1563 0.027518811440427
Disease Target Count Z-score Confidence
Hypertension 293 4.938 2.5

Expression

Synonym

Accession Q13228 A6NML9 A6PVW9 B2RDR3 B4DKP6 B4E1F3 Q49AQ8 Q96GX7
Symbols LPSB
SP56
hSBP
SBP56
HEL-S-134P

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

 GO Function (1)

 GO Process (1)

Gene RIF (31)

PMID Text
26593911 cysteine 57 is a critical determinant of SBP1 function and may play a significant role in mitochondrial function.
26241353 elevated transcript expression is widespread throughout the prefrontal cortex in schizophrenia
25993660 Data indicate that loss of SBP1 may play an independent contributing role in prostate cancer progression and its levels might be useful in distinguishing indolent from aggressive disease.
25974208 These results have revealed a novel mechanism that SELENBP1-mediated cancer inhibition is through altering lipid/glucose metabolic signaling pathways.
25227434 Decreased selenium-binding protein 1 mRNA expression is associated with renal cell carcinoma.
24874852 hSP56 plays an important role in regulating HIF-1alpha, which may be one of mechanisms of hSP56 expression in suppressing the malignant characteristics of prostate cancer cells.
24737289 the downregulated SELENBP1 expression was reactivated by inducing differentiation. Therefore, SELENBP1 is a potential pharmacological target for individualized CRC treatment.
23977169 Decreased SELENBP1 expression is an early event in lung squamous cell cancer tumorigenesis.
23704933 The expression level of SELENBP1 could be an important marker for predicting survival and effectiveness of selenium supplementation in breast cancer.
23483240 These results suggest that SBP1 plays a significant role in gastric cancer cell proliferation and modulates its response to anticancer drugs
More...

AA Sequence

MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVDPKSPQYCQVIHRLPMPNLKD      1 - 70
ELHHSGWNTCSSCFGDSTKSRTKLVLPSLISSRIYVVDVGSEPRAPKLHKVIEPKDIHAKCELAFLHTSH     71 - 140
CLASGEVMISSLGDVKGNGKGGFVLLDGETFEVKGTWERPGGAAPLGYDFWYQPRHNVMISTEWAAPNVL    141 - 210
RDGFNPADVEAGLYGSHLYVWDWQRHEIVQTLSLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKN    211 - 280
EGGTWSVEKVIQVPPKKVKGWLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLF    281 - 350
LGGSIVKGGPVQVLEDEELKSQPEPLVVKGKRVAGGPQMIQLSLDGKRLYITTSLYSAWDKQFYPDLIRE    351 - 420
GSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI                      421 - 472
//

Text Mined References (58)

PMID Year Title
26593911 2015 A Critical Role for Cysteine 57 in the Biological Functions of Selenium Binding Protein-1.
26241353 2015 SELENBP1 expression in the prefrontal cortex of subjects with schizophrenia.
25993660 2015 Evidence that selenium binding protein 1 is a tumor suppressor in prostate cancer.
25974208 2015 Quantitative proteomic analysis reveals that anti-cancer effects of selenium-binding protein 1 in vivo are associated with metabolic pathways.
25227434 2014 Decreased selenium-binding protein 1 mRNA expression is associated with poor prognosis in renal cell carcinoma.
24874852 2014 Human selenium binding protein-1 (hSP56) is a negative regulator of HIF-1? and suppresses the malignant characteristics of prostate cancer cells.
24737289 2014 Selenium-binding protein 1 is associated with the degree of colorectal cancer differentiation and is regulated by histone modification.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23977169 2013 The function and significance of SELENBP1 downregulation in human bronchial epithelial carcinogenic process.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
More...