Property Summary

NCBI Gene PubMed Count 39
PubMed Score 9.50
PubTator Score 38.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

 MGI Phenotype (1)

Gene RIF (16)

AA Sequence

MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQIL      1 - 70
KLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNR     71 - 140
PGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQL    141 - 210
RAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALH    211 - 280
PAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK                           281 - 327
//

Text Mined References (42)

PMID Year Title