Property Summary

NCBI Gene PubMed Count 32
Grant Count 34
R01 Count 7
Funding $4,415,094.45
PubMed Score 9.57
PubTator Score 38.38

Knowledge Summary

Patent

No data available

Gene RIF (14)

PMID Text
26070566 regulation of GPS2 by posttranslational modifications provides an effective strategy for modulating its molecular function within the nuclear compartment.
25139254 Chromosomal translocation in a pediatric undifferentiated spindle cell sarcoma have characterized this alteration to show rearrangement of the MLL4 and GPS2 genes, resulting in fusion gene MLL4-GPS2, the expression of which promotes independent growth.
24943844 Posttranslational modification of GPS2 by SUMOylation may serve as a key factor that regulates the function of GPS2 in vivo.
24223774 GPS2 is required for the association of viral NS5A with VAP-A and hepatitis C virus replication.
23221346 expression of the transcriptional corepressor complex subunits GPS2 and SMRT was significantly reduced in obese adipose tissue, inversely correlated to inflammatory status
22190034 HIV-1 Vif is identified to have a physical interaction with G protein pathway suppressor 2 (GPS2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20159957 metabolically important coregulator GPS2 functions as a hitherto unrecognized transrepression mediator of interactions between SUMOylated nuclear receptors and the N-CoR corepressor complex
19917673 Results show for the first time that GPS-2 is differentially methylated at a site that lacks known methylation motifs and that the methylation state is detected by the immune system
19858209 G protein pathway suppressor 2 (GPS2) is a transcriptional corepressor important for estrogen receptor alpha-mediated transcriptional regulation.
19481530 Data describe the requirement of GPS2 for ABCG1 gene transcription and cholesterol efflux from macrophages, and implicate GPS2 in facilitating LXRalpha/beta recruitment to an ABCG1-specific promoter/enhancer unit upon ligand activation.
More...

AA Sequence

MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQIL      1 - 70
KLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNR     71 - 140
PGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQL    141 - 210
RAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALH    211 - 280
PAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK                           281 - 327
//

Text Mined References (35)

PMID Year Title
26070566 2015 Exchange Factor TBL1 and Arginine Methyltransferase PRMT6 Cooperate in Protecting G Protein Pathway Suppressor 2 (GPS2) from Proteasomal Degradation.
25416956 2014 A proteome-scale map of the human interactome network.
25139254 2014 Identification of an MLL4-GPS2 fusion as an oncogenic driver of undifferentiated spindle cell sarcoma in a child.
24943844 2014 SUMOylation of GPS2 protein regulates its transcription-suppressing function.
24223774 2013 GPS2 is required for the association of NS5A with VAP-A and hepatitis C virus replication.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23221346 2013 SMRT-GPS2 corepressor pathway dysregulation coincides with obesity-linked adipocyte inflammation.
22190034 2011 Global landscape of HIV-human protein complexes.
20159957 2010 GPS2-dependent corepressor/SUMO pathways govern anti-inflammatory actions of LRH-1 and LXRbeta in the hepatic acute phase response.
19917673 2010 Differential arginine methylation of the G-protein pathway suppressor GPS-2 recognized by tumor-specific T cells in melanoma.
More...