Property Summary

NCBI Gene PubMed Count 29
PubMed Score 24.77
PubTator Score 23.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Retinitis pigmentosa 17 7 3.854 1.9
Feingold syndrome 14 3.763 1.9

Expression

  Differential Expression (20)

Disease log2 FC p
diabetes mellitus -1.300 3.8e-03
active Crohn's disease 1.578 2.7e-02
acute quadriplegic myopathy 1.266 8.8e-06
adult high grade glioma 1.100 4.7e-03
Alzheimer's disease 1.600 3.1e-02
atypical teratoid / rhabdoid tumor 1.200 2.2e-02
ependymoma 1.300 1.4e-05
glioblastoma 1.100 3.2e-02
juvenile dermatomyositis 1.183 1.1e-10
medulloblastoma, large-cell -1.100 1.5e-02
osteosarcoma 4.524 4.6e-09
ovarian cancer -1.600 6.7e-05
pancreatic ductal adenocarcinoma liver m... -2.188 3.4e-03
Pick disease 2.700 6.5e-05
pituitary cancer -2.000 2.1e-03
psoriasis -1.300 9.7e-03
Rheumatoid arthritis 3.700 2.4e-03
sarcoidosis 1.200 1.1e-02
subependymal giant cell astrocytoma 1.536 1.3e-02
ulcerative colitis 1.100 2.7e-03

Protein-protein Interaction (6)

Gene RIF (11)

AA Sequence

MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDN      1 - 70
YIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENE     71 - 140
EKEAQSQLIKSDEMQRLRSQALNAFGSGDYTAAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISD    141 - 210
LKAASKLKNDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIR    211 - 280
DGRYTDATSKYESVMKTEPSIAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAY    281 - 350
LIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ    351 - 420
WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHRSWNSWQGFNP    421 - 490
FSSGGPFRFKFHFN                                                            491 - 504
//

Text Mined References (33)

PMID Year Title