Property Summary

NCBI Gene PubMed Count 29
Grant Count 17
R01 Count 9
Funding $1,170,457.12
PubMed Score 23.53
PubTator Score 23.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis 3.700 0.002
psoriasis -1.300 0.010
osteosarcoma 4.524 0.000
ependymoma 1.300 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.600 0.000
medulloblastoma, large-cell 1.600 0.000
juvenile dermatomyositis 1.183 0.000
acute quadriplegic myopathy 1.266 0.000
pancreatic ductal adenocarcinoma liver m... -2.188 0.003
active Crohn's disease 1.578 0.027
sarcoidosis 1.200 0.011
diabetes mellitus -1.300 0.004
pediatric high grade glioma 1.100 0.003
subependymal giant cell astrocytoma 1.536 0.013
Alzheimer's disease 1.600 0.031
Pick disease 2.700 0.000
ulcerative colitis 1.300 0.000
ovarian cancer 2.700 0.000
pituitary cancer -2.000 0.002

Gene RIF (10)

PMID Text
25466870 Loss-of-function DNAJC3 mutations lead to a monogenic, recessive form of diabetes mellitus in humans.
25329545 p58IPK is a general inhibitor of the eIF2alpha kinases in that it also interacts with GCN2. Thus forced overexpression of cytoplasmic p58 delays eIF2alpha phosphorylation, suppresses GCN2 phosphorylation and prolongs protein synthesis
24134518 p58(IPK) suppresses coxsackievirus B3-induced apoptosis through selective activation of PI3K/Akt pathway that requires activation of ATF6a and subsequently upregulates mitofusin 2.
22064321 interplay between p38 phosphorylation and p58(IPK) upregulation has key roles in modulating ERp29-induced cell-growth arrest and survival
21799829 the crystal structure of human P58(IPK)
20554776 Coxsackievirus B3 infection induces apoptosis through downregulation of p58IPK and activation of CHOP and SREBP1.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18568130 The study demonstrates that P58(IPK) inhibits endoplasmic reticulum (ER) stress and plays an important role in maintaining balance and stability of the ER in human retinal capillary endothelial cells.
12601012 P58(IPK) is an important component of a negative feedback loop used by the cell to inhibit eIF2alpha signaling, and thus attenuate the unfolded protein response.
12034040 Spleen cells from transgenic mice overexpressing (Hu)PKR were studied and compared to those from wild-type mice after drug treatment. Dact-treated spleen cells were resistant to apoptosis; ConA-treated cells had decreased cell division.

AA Sequence

MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDN      1 - 70
YIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENE     71 - 140
EKEAQSQLIKSDEMQRLRSQALNAFGSGDYTAAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISD    141 - 210
LKAASKLKNDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIR    211 - 280
DGRYTDATSKYESVMKTEPSIAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAY    281 - 350
LIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ    351 - 420
WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHRSWNSWQGFNP    421 - 490
FSSGGPFRFKFHFN                                                            491 - 504
//

Text Mined References (33)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25466870 2014 Absence of BiP co-chaperone DNAJC3 causes diabetes mellitus and multisystemic neurodegeneration.
25329545 2015 p58IPK is an inhibitor of the eIF2? kinase GCN2 and its localization and expression underpin protein synthesis and ER processing capacity.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24134518 2014 P58(IPK) inhibits coxsackievirus-induced apoptosis via the PI3K/Akt pathway requiring activation of ATF6a and subsequent upregulation of mitofusin 2.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22064321 2012 ERp29 induces breast cancer cell growth arrest and survival through modulation of activation of p38 and upregulation of ER stress protein p58IPK.
21799829 2011 The crystal structure of the human co-chaperone P58(IPK).
More...