Property Summary

NCBI Gene PubMed Count 43
Grant Count 44
R01 Count 34
Funding $5,076,135.97
PubMed Score 21.68
PubTator Score 1610.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.273 0.022
primitive neuroectodermal tumor 1.100 0.000
group 3 medulloblastoma 1.400 0.001
pituitary cancer 1.100 0.000

 GO Function (1)

 GWAS Trait (1)

Gene RIF (28)

PMID Text
26616585 Although the absence of CSA had no effect on CSB recruitment, CSA itself localized at sites of interstrand crosslinks, double-strand breaks and monoadducts but not at oxidative DNA lesions.
26130415 Our findings suggested that ERCC8 rs158572 and rs158916, alone or together with environmental factors, might be associated with gastric cancer and atrophic gastritis susceptibility.
24781187 A novel function of Cockayne syndrome A protein as transcription factor of RNA polymerase I in the nucleolus is shown.
23583689 The review focuses on the participation of the CSB and CSA proteins in many different protein interactions and complexes, and how these interactions inform us about pathways that are defective in the disease.
23571135 The role of CSA protein in TC-NER is described in this review
23562424 The role of CSA and CSB protein in the oxidative stress response.
23562423 Mitochondrial CSA and CSB: protein interactions and protection from ageing associated DNA mutations.
22902626 KIAA1530 protein is recruited by Cockayne syndrome complementation group protein A (CSA) to participate in transcription-coupled repair (TCR).
22232169 crystals of CSA-DDB1 had unit-cell parameters a = b = 142.03, c = 250.19 A and diffracted to 2.9 A resolution on beamline ID14-1
22032989 CSA and CSB are identified as the key elements of a regulatory mechanism that equilibrate beneficial and detrimental effects of p53 activity upon cellular stress.
More...

AA Sequence

MLGFLSARQTGLEDPLRLRRAESTRRVLGLELNKDRDVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVL      1 - 70
YDLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSFDKTLKVWDTNTLQTADVFNF     71 - 140
EETVYSHHMSPVSTKHCLVAVGTRGPKVQLCDLKSGSCSHILQGHRQEILAVSWSPRYDYILATASADSR    141 - 210
VKLWDVRRASGCLITLDQHNGKKSQAVESANTAHNGKVNGLCFTSDGLHLLTVGTDNRMRLWNSSNGENT    211 - 280
LVNYGKVCNNSKKGLKFTVSCGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELY    281 - 350
SGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG                            351 - 396
//

Text Mined References (46)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26616585 2016 Elements That Regulate the DNA Damage Response of Proteins Defective in Cockayne Syndrome.
26130415 2015 Effect of ERCC8 tagSNPs and their association with H. pylori infection, smoking, and alcohol consumption on gastric cancer and atrophic gastritis risk.
24781187 2014 Cockayne syndrome protein A is a transcription factor of RNA polymerase I and stimulates ribosomal biogenesis and growth.
23583689 Multiple interaction partners for Cockayne syndrome proteins: implications for genome and transcriptome maintenance.
23571135 The role of Cockayne syndrome group A (CSA) protein in transcription-coupled nucleotide excision repair.
23562424 The role of CSA and CSB protein in the oxidative stress response.
23562423 Mitochondrial CSA and CSB: protein interactions and protection from ageing associated DNA mutations.
22902626 2012 KIAA1530 protein is recruited by Cockayne syndrome complementation group protein A (CSA) to participate in transcription-coupled repair (TCR).
22466612 2012 Mutations in UVSSA cause UV-sensitive syndrome and destabilize ERCC6 in transcription-coupled DNA repair.
More...