Property Summary

NCBI Gene PubMed Count 56
PubMed Score 116.11
PubTator Score 67.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.700 3.2e-03
lung adenocarcinoma -1.800 4.7e-07
lung cancer -1.600 1.6e-04
medulloblastoma, large-cell 1.200 4.8e-02
non-small cell lung cancer -1.625 5.7e-16
osteosarcoma 1.393 9.1e-06
subependymal giant cell astrocytoma 2.016 1.5e-02

Gene RIF (36)

AA Sequence

MREPALAASAMAYHPFHAPRPADFPMSAFLAAAQPSFFPALALPPGALAKPLPDPGLAGAAAAAAAAAAA      1 - 70
AEAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHKLGTEMVITKSGRRMFPPFKV     71 - 140
RVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLK    141 - 210
LTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNP    211 - 280
FAKGFRDTGNGRREKRKQLTLPSLRLYEEHCKPERDGAESDASSCDPPPAREPPTSPGAAPSPLRLHRAR    281 - 350
AEEKSCAADSDPEPERLSEERAGAPLGRSPAPDSASPTRLTEPERARERRSPERGKEPAESGGDGPFGLR    351 - 420
SLEKERAEARRKDEGRKEAAEGKEQGLAPLVVQTDSASPLGAGHLPGLAFSSHLHGQQFFGPLGAGQPLF    421 - 490
LHPGQFTMGPGAFSAMGMGHLLASVAGGGNGGGGGPGTAAGLDAGGLGPAASAASTAAPFPFHLSQHMLA    491 - 560
SQGIPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAAAAAAAGSLSRSPFLGSARPRLRFSPYQIPVTI    561 - 630
PPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLES    631 - 700
QRALSPGRESPK                                                              701 - 712
//

Text Mined References (59)

PMID Year Title