Property Summary

NCBI Gene PubMed Count 55
Grant Count 64
R01 Count 36
Funding $8,629,747.79
PubMed Score 109.61
PubTator Score 67.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.393 0.000
atypical teratoid / rhabdoid tumor 1.700 0.003
medulloblastoma, large-cell 1.200 0.048
non-small cell lung cancer -1.777 0.000
lung cancer -1.600 0.000
subependymal giant cell astrocytoma 2.156 0.005
lung adenocarcinoma -1.800 0.000

Synonym

Accession Q13207 Q16424 Q7Z647 T-box protein 2
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (35)

PMID Text
25394776 this new molecular-grade based on the combination of TBX2 and TBX3 methylation is an excellent marker for predicting progression to muscle-invasive bladder cancer in patients with primary pTaG1/2 bladder cancer.
25371204 Data show that the down-regulation of T-box transcription factor TBX2 by transforming growth factor beta I (TGF-beta1) is mediated by T-box transcription factor TBX3.
25344916 Our results suggest a conserved role of Tbx2-related proteins in cell invasion and metastasis-related processes
25027744 High TBX2 expression is associated with non-small cell lung cancer.
24742492 High TBX2 expression is associated with breast cancer.
24470334 deregulated TBX2 serves as an oncogene in rhabdomyosarcoma
24309999 The data suggested that the DNA sequence variants within the TBX2 gene promoter was implicated in the indirect inguinal hernia development as a rare cause.
24113180 Knocking down TBX2 sensitises the cells to cisplatin by disrupting the ATM-CHK2-p53 signalling pathway.
23959449 TBX2 was a significantly prognostic factor for decreased survival.
23727221 DNA sequence variants within TBX2 gene promoter may contribute to ventricular septal defects ethiology
More...

AA Sequence

MREPALAASAMAYHPFHAPRPADFPMSAFLAAAQPSFFPALALPPGALAKPLPDPGLAGAAAAAAAAAAA      1 - 70
AEAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHKLGTEMVITKSGRRMFPPFKV     71 - 140
RVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLK    141 - 210
LTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNP    211 - 280
FAKGFRDTGNGRREKRKQLTLPSLRLYEEHCKPERDGAESDASSCDPPPAREPPTSPGAAPSPLRLHRAR    281 - 350
AEEKSCAADSDPEPERLSEERAGAPLGRSPAPDSASPTRLTEPERARERRSPERGKEPAESGGDGPFGLR    351 - 420
SLEKERAEARRKDEGRKEAAEGKEQGLAPLVVQTDSASPLGAGHLPGLAFSSHLHGQQFFGPLGAGQPLF    421 - 490
LHPGQFTMGPGAFSAMGMGHLLASVAGGGNGGGGGPGTAAGLDAGGLGPAASAASTAAPFPFHLSQHMLA    491 - 560
SQGIPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAAAAAAAGSLSRSPFLGSARPRLRFSPYQIPVTI    561 - 630
PPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLES    631 - 700
QRALSPGRESPK                                                              701 - 712
//

Text Mined References (58)

PMID Year Title
25394776 2015 Stratification based on methylation of TBX2 and TBX3 into three molecular grades predicts progression in patients with pTa-bladder cancer.
25371204 2014 The anti-proliferative function of the TGF-?1 signaling pathway involves the repression of the oncogenic TBX2 by its homologue TBX3.
25344916 2014 The orthologous Tbx transcription factors Omb and TBX2 induce epithelial cell migration and extrusion in vivo without involvement of matrix metalloproteinases.
25027744 2014 High TBX2 expression predicts poor prognosis in non-small cell lung cancer.
24742492 2014 TBX2 represses CST6 resulting in uncontrolled legumain activity to sustain breast cancer proliferation: a novel cancer-selective target pathway with therapeutic opportunities.
24470334 2014 TBX2 blocks myogenesis and promotes proliferation in rhabdomyosarcoma cells.
24309999 2014 Genetic analysis of the TBX2 gene promoter in indirect inguinal hernia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24113180 2013 A novel role for the anti-senescence factor TBX2 in DNA repair and cisplatin resistance.
23959449 2013 Increased expression of TBX2 is a novel independent prognostic biomarker of a worse outcome in colorectal cancer patients after curative surgery and a potential therapeutic target.
More...