Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.48
PubTator Score 9.53

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.27689663217568E-4
psoriasis 6685 3.87470708201102E-4
lung cancer 4473 5.8068533363773E-4
oligodendroglioma 2849 0.00275888479419468
diabetes mellitus 1663 0.00902686466419913
Disease Target Count Z-score Confidence
acute myeloid leukemia 785 3.52 1.8


  Differential Expression (5)

Disease log2 FC p
oligodendroglioma -1.100 0.003
psoriasis 1.100 0.000
lung cancer 1.900 0.001
diabetes mellitus -1.100 0.009
ovarian cancer 1.100 0.000


Accession Q13206 B2RCQ3 Q5BJD8
Symbols HRH-J8




  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Pathway (1)

Gene RIF (7)

26713367 Taken together, in current study, we found a novel tumor suppressor, DDX10, is epigenetic silenced by miR-155-5p in ovarian cancer, and the down-regulated expression pattern of DDX10 promotes ovarian cancer proliferation through Akt/NF-kappaB pathway.
25701821 siRNA knockdown of DDX10 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV demonstrates decreased infectivity.
25701821 siRNA knockdown of DDX10 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV demonstrates decreased infectivity.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
19332556 The 50S U3 snoRNP is an small subunit assembly intermediate that is likely recruited to the pre-rRNA through the RNA-binding proteins nucleolin and RRP5.[RRP5, DBP4]
18187620 siRNA knockdown of DDX10 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV demonstrates decreased infectivity.
9199348 The rRNA-processing function of the yeast U14 small nucleolar RNA can be rescued by a conserved RNA helicase-like protein.

AA Sequence

HNRKKARWDTLEPLDTGLSLAEDEELVLHLLRSQS                                       841 - 875

Text Mined References (26)

PMID Year Title
26713367 2016 Epigenetic down-regulated DDX10 promotes cell proliferation through Akt/NF-?B pathway in ovarian cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20941364 2010 Comparative structural analysis of human DEAD-box RNA helicases.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19332556 2009 A novel small-subunit processome assembly intermediate that contains the U3 snoRNP, nucleolin, RRP5, and DBP4.