Property Summary

NCBI Gene PubMed Count 12
PubMed Score 324.42
PubTator Score 53.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.477 5.1e-05
Becker muscular dystrophy 1.179 4.4e-03
Duchenne muscular dystrophy 1.680 1.6e-08
juvenile dermatomyositis 1.681 2.2e-05
limb girdle muscular dystrophy 2A 1.262 3.1e-06
lung adenocarcinoma 1.800 1.8e-04
psoriasis -1.200 1.9e-04

Gene RIF (5)

AA Sequence

MMEKNTSEGPACSPEETASESAKVPTAEPPGEVAVSESTREEQVPKPQAPAPQAPTASTATKPAPPSEDV      1 - 70
PSAPLLLTLDDVSSSSVTVSWEPPERLGRLGLQGYVLELCREGASEWVPVSARPMMVTQQTVRNLALGDK     71 - 140
FLLRVSAVSSAGAGPPAMLDQPIHIRENIEAPKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTH    141 - 210
NGHALDSQRVSMRTGDQDSILFIRSAQRSDSGRYELTVRVEDLEAKAVIDILVIEKPGPPSSIRLLDVWG    211 - 280
CNAALQWTPPQDTGNTELLGYMVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFRVFSENLCGLST    281 - 350
SATVTKELAHIQKADIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYSTQLFCSVRASPKPKIIWMKNKM    351 - 420
EIQGNPKYRALSEQGVCTLEIRKPSPFDSGVYTCKAINVLGEASVDCRLEVKASAAH                 421 - 477
//

Text Mined References (12)

PMID Year Title