Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
Funding $225,707.2
PubMed Score 64.50
PubTator Score 16.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -2.700 0.000
astrocytoma -1.100 0.000
glioblastoma -1.800 0.000
osteosarcoma 2.390 0.000
posterior fossa group B ependymoma -2.900 0.000
atypical teratoid/rhabdoid tumor -2.000 0.000
non-small cell lung cancer -1.169 0.000
lung cancer -1.600 0.000
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -2.300 0.000
subependymal giant cell astrocytoma -1.844 0.039
non-inflammatory breast cancer -1.300 0.004

Synonym

Accession Q13202 Q86SS8
Symbols HB5
HVH8
HVH-5
C11orf81

Gene

PDB

4JMK  

Gene RIF (3)

PMID Text
22100391 The phosphorylation of the M3/6 phosphatase by JNK in response to stress stimuli results in attenuation of phosphatase activity and acceleration of JNK activation.
15899389 Because this variant of hVH-5 lacked intronic sequences in its genomic structure, we suggest it might be a processed pseudogene of hVH-5.
13129832 DUSP8 is genetically linked to alcohol dependence and was found on chromosome 11p15.5

AA Sequence

MAGDRLPRKVMDAKKLASLLRGGPGGPLVIDSRSFVEYNSWHVLSSVNICCSKLVKRRLQQGKVTIAELI      1 - 70
QPAARSQVEATEPQDVVVYDQSTRDASVLAADSFLSILLSKLDGCFDSVAILTGGFATFSSCFPGLCEGK     71 - 140
PAALLPMSLSQPCLPVPSVGLTRILPHLYLGSQKDVLNKDLMTQNGISYVLNASNSCPKPDFICESRFMR    141 - 210
VPINDNYCEKLLPWLDKSIEFIDKAKLSSCQVIVHCLAGISRSATIAIAYIMKTMGMSSDDAYRFVKDRR    211 - 280
PSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAREG    281 - 350
GLSAGGEPPAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRPDGPGPPDPGEAP    351 - 420
KLCKLDSPSGAALGLSSPSPDSPDAAPEARPRPRRRPRPPAGSPARSPAHSLGLNFGDAARQTPRHGLSA    421 - 490
LSAPGLPGPGQPAGPGAWAPPLDSPGTPSPDGPWCFSPEGAQGAGGVLFAPFGRAGAPGPGGGSDLRRRE    491 - 560
AARAEPRDARTGWPEEPAPETQFKRRSCQMEFEEGMVEGRARGEELAALGKQASFSGSVEVIEVS         561 - 625
//

Text Mined References (12)

PMID Year Title
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
22100391 2012 Phosphorylation of the M3/6 dual-specificity phosphatase enhances the activation of JNK by arsenite.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15899389 2005 Identification of a transcriptionally active hVH-5 pseudogene on 10q22.2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
13129832 2003 Investigation of DUSP8 and CALCA in alcohol dependence.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9192849 1997 Genomic organization and chromosomal localization of a member of the MAP kinase phosphatase gene family to human chromosome 11p15.5 and a pseudogene to 10q11.2.
More...