Property Summary

NCBI Gene PubMed Count 27
Grant Count 10
R01 Count 6
Funding $1,801,648.25
PubMed Score 90.42
PubTator Score 548.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

 GO Function (1)

Gene RIF (11)

PMID Text
26446635 Lower levels of anti-elastin are related to CAD [ coronary artery disease ]
25825478 our studies identify MMRN1 expression as a novel biomarker that may refine acute myelogenous leukemia risk stratification.
21058943 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19175495 MMRN1 supported the adhesion of activated, but not resting, washed platelets over a wide range of shear rates
19132231 Multimerin 1 binds factor V and activated factor V with high affinity and inhibits thrombin generation.
18452976 The MMRN1 binding site was located in Factor V.
16363244 MMRN1 is a ligand for alphaIIbbeta3 and alphavbeta3
15849733 Observational study of genotype prevalence. (HuGE Navigator)
15583744 disulfide-linked complexes of multimerin and factor V in platelets could be important for modulating the function of platelet factor V and its delivery onto activated platelets
More...

AA Sequence

MKGARLFVLLSSLWSGGIGLNNSKHSWTIPEDGNSQKTMPSASVPPNKIQSLQILPTTRVMSAEIATTPE      1 - 70
ARTSEDSLLKSTLPPSETSAPAEGVRNQTLTSTEKAEGVVKLQNLTLPTNASIKFNPGAESVVLSNSTLK     71 - 140
FLQSFARKSNEQATSLNTVGGTGGIGGVGGTGGVGNRAPRETYLSRGDSSSSQRTDYQKSNFETTRGKNW    141 - 210
CAYVHTRLSPTVILDNQVTYVPGGKGPCGWTGGSCPQRSQKISNPVYRMQHKIVTSLDWRCCPGYSGPKC    211 - 280
QLRAQEQQSLIHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNISLTVN    281 - 350
DVRNTYSSLEGKVSEDKSREFQSLLKGLKSKSINVLIRDIVREQFKIFQNDMQETVAQLFKTVSSLSEDL    351 - 420
ESTRQIIQKVNESVVSIAAQQKFVLVQENRPTLTDIVELRNHIVNVRQEMTLTCEKPIKELEVKQTHLEG    421 - 490
ALEQEHSRSILYYESLNKTLSKLKEVHEQLLSTEQVSDQKNAPAAESVSNNVTEYMSTLHENIKKQSLMM    491 - 560
LQMFEDLHIQESKINNLTVSLEMEKESLRGECEDMLSKCRNDFKFQLKDTEENLHVLNQTLAEVLFPMDN    561 - 630
KMDKMSEQLNDLTYDMEILQPLLEQGASLRQTMTYEQPKEAIVIRKKIENLTSAVNSLNFIIKELTKRHN    631 - 700
LLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDME    701 - 770
TILTFIPQFHRLNDSIQTLVNDNQRYNFVLQVAKTLAGIPRDEKLNQSNFQKMYQMFNETTSQVRKYQQN    771 - 840
MSHLEEKLLLTTKISKNFETRLQDIESKVTQTLIPYYISVKKGSVVTNERDQALQLQVLNSRFKALEAKS    841 - 910
IHLSINFFSLNKTLHEVLTMCHNASTSVSELNATIPKWIKHSLPDIQLLQKGLTEFVEPIIQIKTQAALS    911 - 980
NLTCCIDRSLPGSLANVVKSQKQVKSLPKKINALKKPTVNLTTVLIGRTQRNTDNIIYPEEYSSCSRHPC    981 - 1050
QNGGTCINGRTSFTCACRHPFTGDNCTIKLVEENALAPDFSKGSYRYAPMVAFFASHTYGMTIPGPILFN   1051 - 1120
NLDVNYGASYTPRTGKFRIPYLGVYVFKYTIESFSAHISGFLVVDGIDKLAFESENINSEIHCDRVLTGD   1121 - 1190
ALLELNYGQEVWLRLAKGTIPAKFPPVTTFSGYLLYRT                                   1191 - 1228
//

Text Mined References (32)

PMID Year Title
26627825 2016 Extracellular Fibrinogen-binding Protein (Efb) from Staphylococcus aureus Inhibits the Formation of Platelet-Leukocyte Complexes.
26446635 2015 Circulating Anti-Elastin Antibody Levels and Arterial Disease Characteristics: Associations with Arterial Stiffness and Atherosclerosis.
25825478 2015 Multimerin-1 (MMRN1) as Novel Adverse Marker in Pediatric Acute Myeloid Leukemia: A Report from the Children's Oncology Group.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
21058943 2011 Replication of GWAS associations for GAK and MAPT in Parkinson's disease.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
19175495 2009 Platelet adhesion to multimerin 1 in vitro: influences of platelet membrane receptors, von Willebrand factor and shear.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
More...