Property Summary

NCBI Gene PubMed Count 28
PubMed Score 98.39
PubTator Score 548.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 1.6e-05
Atopic dermatitis -2.200 2.2e-03
atypical teratoid / rhabdoid tumor 1.100 2.8e-02
breast carcinoma -1.100 3.6e-04
colon cancer -2.400 2.4e-06
ependymoma 2.200 4.1e-07
gastric cancer 1.200 2.5e-02
glioblastoma 1.100 1.0e-04
interstitial cystitis 2.800 7.5e-03
intraductal papillary-mucinous adenoma (... -1.600 1.1e-03
intraductal papillary-mucinous carcinoma... -1.500 2.6e-03
invasive ductal carcinoma -1.500 4.7e-02
lung adenocarcinoma -1.800 8.0e-09
lung cancer -1.700 3.8e-02
lung carcinoma -2.200 1.6e-08
non-small cell lung cancer -2.105 3.2e-16
osteosarcoma -1.822 4.5e-03
pancreatic cancer 1.400 8.3e-03
pancreatic carcinoma 1.400 8.3e-03
pediatric high grade glioma 1.100 1.2e-05
primitive neuroectodermal tumor 1.600 7.3e-03
psoriasis -1.400 1.4e-04

 GO Function (1)

Gene RIF (12)

AA Sequence

MKGARLFVLLSSLWSGGIGLNNSKHSWTIPEDGNSQKTMPSASVPPNKIQSLQILPTTRVMSAEIATTPE      1 - 70
ARTSEDSLLKSTLPPSETSAPAEGVRNQTLTSTEKAEGVVKLQNLTLPTNASIKFNPGAESVVLSNSTLK     71 - 140
FLQSFARKSNEQATSLNTVGGTGGIGGVGGTGGVGNRAPRETYLSRGDSSSSQRTDYQKSNFETTRGKNW    141 - 210
CAYVHTRLSPTVILDNQVTYVPGGKGPCGWTGGSCPQRSQKISNPVYRMQHKIVTSLDWRCCPGYSGPKC    211 - 280
QLRAQEQQSLIHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNISLTVN    281 - 350
DVRNTYSSLEGKVSEDKSREFQSLLKGLKSKSINVLIRDIVREQFKIFQNDMQETVAQLFKTVSSLSEDL    351 - 420
ESTRQIIQKVNESVVSIAAQQKFVLVQENRPTLTDIVELRNHIVNVRQEMTLTCEKPIKELEVKQTHLEG    421 - 490
ALEQEHSRSILYYESLNKTLSKLKEVHEQLLSTEQVSDQKNAPAAESVSNNVTEYMSTLHENIKKQSLMM    491 - 560
LQMFEDLHIQESKINNLTVSLEMEKESLRGECEDMLSKCRNDFKFQLKDTEENLHVLNQTLAEVLFPMDN    561 - 630
KMDKMSEQLNDLTYDMEILQPLLEQGASLRQTMTYEQPKEAIVIRKKIENLTSAVNSLNFIIKELTKRHN    631 - 700
LLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDME    701 - 770
TILTFIPQFHRLNDSIQTLVNDNQRYNFVLQVAKTLAGIPRDEKLNQSNFQKMYQMFNETTSQVRKYQQN    771 - 840
MSHLEEKLLLTTKISKNFETRLQDIESKVTQTLIPYYISVKKGSVVTNERDQALQLQVLNSRFKALEAKS    841 - 910
IHLSINFFSLNKTLHEVLTMCHNASTSVSELNATIPKWIKHSLPDIQLLQKGLTEFVEPIIQIKTQAALS    911 - 980
NLTCCIDRSLPGSLANVVKSQKQVKSLPKKINALKKPTVNLTTVLIGRTQRNTDNIIYPEEYSSCSRHPC    981 - 1050
QNGGTCINGRTSFTCACRHPFTGDNCTIKLVEENALAPDFSKGSYRYAPMVAFFASHTYGMTIPGPILFN   1051 - 1120
NLDVNYGASYTPRTGKFRIPYLGVYVFKYTIESFSAHISGFLVVDGIDKLAFESENINSEIHCDRVLTGD   1121 - 1190
ALLELNYGQEVWLRLAKGTIPAKFPPVTTFSGYLLYRT                                   1191 - 1228
//

Text Mined References (33)

PMID Year Title