Property Summary

NCBI Gene PubMed Count 27
PubMed Score 90.42
PubTator Score 548.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 3.23501999207913E-16
breast carcinoma 1614 7.58418990055755E-14
lung adenocarcinoma 2714 8.44666439691564E-10
lung carcinoma 2844 1.64304325241702E-8
lung cancer 4473 1.12787046499385E-6
posterior fossa group B ependymoma 1530 1.27326880392529E-6
colon cancer 1475 2.37827192534946E-6
pediatric high grade glioma 2712 1.24608797213611E-5
pilocytic astrocytoma 3086 1.4298289463381E-5
interstitial cystitis 2299 1.02103692498382E-4
glioblastoma 5572 1.04350970742092E-4
psoriasis 6685 1.40359117856815E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0010689980770062
Atopic dermatitis 944 0.00218101511182822
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00262973641656345
osteosarcoma 7933 0.00453654969704032
primitive neuroectodermal tumor 3031 0.0072709391655297
pancreatic cancer 2300 0.00829373669339935
pancreatic carcinoma 567 0.00829373669339937
gastric cancer 436 0.0253691414383319
atypical teratoid / rhabdoid tumor 4369 0.0283891464032541
invasive ductal carcinoma 2950 0.0471481941470511
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Parkinson's disease 364 0.0 2.0

Expression

  Differential Expression (22)

Synonym

Accession Q13201 Q4W5L1 Q6P3T8 Q6ZUL9
Symbols ECM
MMRN
GPIa*
EMILIN4

Gene

  Ortholog (12)

 GO Function (1)

 IMPC Term (1)

Gene RIF (11)

PMID Text
26446635 Lower levels of anti-elastin are related to CAD [ coronary artery disease ]
25825478 our studies identify MMRN1 expression as a novel biomarker that may refine acute myelogenous leukemia risk stratification.
21058943 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19175495 MMRN1 supported the adhesion of activated, but not resting, washed platelets over a wide range of shear rates
19132231 Multimerin 1 binds factor V and activated factor V with high affinity and inhibits thrombin generation.
18452976 The MMRN1 binding site was located in Factor V.
16363244 MMRN1 is a ligand for alphaIIbbeta3 and alphavbeta3
15849733 Observational study of genotype prevalence. (HuGE Navigator)
15583744 disulfide-linked complexes of multimerin and factor V in platelets could be important for modulating the function of platelet factor V and its delivery onto activated platelets
More...

AA Sequence

MKGARLFVLLSSLWSGGIGLNNSKHSWTIPEDGNSQKTMPSASVPPNKIQSLQILPTTRVMSAEIATTPE      1 - 70
ARTSEDSLLKSTLPPSETSAPAEGVRNQTLTSTEKAEGVVKLQNLTLPTNASIKFNPGAESVVLSNSTLK     71 - 140
FLQSFARKSNEQATSLNTVGGTGGIGGVGGTGGVGNRAPRETYLSRGDSSSSQRTDYQKSNFETTRGKNW    141 - 210
CAYVHTRLSPTVILDNQVTYVPGGKGPCGWTGGSCPQRSQKISNPVYRMQHKIVTSLDWRCCPGYSGPKC    211 - 280
QLRAQEQQSLIHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNISLTVN    281 - 350
DVRNTYSSLEGKVSEDKSREFQSLLKGLKSKSINVLIRDIVREQFKIFQNDMQETVAQLFKTVSSLSEDL    351 - 420
ESTRQIIQKVNESVVSIAAQQKFVLVQENRPTLTDIVELRNHIVNVRQEMTLTCEKPIKELEVKQTHLEG    421 - 490
ALEQEHSRSILYYESLNKTLSKLKEVHEQLLSTEQVSDQKNAPAAESVSNNVTEYMSTLHENIKKQSLMM    491 - 560
LQMFEDLHIQESKINNLTVSLEMEKESLRGECEDMLSKCRNDFKFQLKDTEENLHVLNQTLAEVLFPMDN    561 - 630
KMDKMSEQLNDLTYDMEILQPLLEQGASLRQTMTYEQPKEAIVIRKKIENLTSAVNSLNFIIKELTKRHN    631 - 700
LLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDME    701 - 770
TILTFIPQFHRLNDSIQTLVNDNQRYNFVLQVAKTLAGIPRDEKLNQSNFQKMYQMFNETTSQVRKYQQN    771 - 840
MSHLEEKLLLTTKISKNFETRLQDIESKVTQTLIPYYISVKKGSVVTNERDQALQLQVLNSRFKALEAKS    841 - 910
IHLSINFFSLNKTLHEVLTMCHNASTSVSELNATIPKWIKHSLPDIQLLQKGLTEFVEPIIQIKTQAALS    911 - 980
NLTCCIDRSLPGSLANVVKSQKQVKSLPKKINALKKPTVNLTTVLIGRTQRNTDNIIYPEEYSSCSRHPC    981 - 1050
QNGGTCINGRTSFTCACRHPFTGDNCTIKLVEENALAPDFSKGSYRYAPMVAFFASHTYGMTIPGPILFN   1051 - 1120
NLDVNYGASYTPRTGKFRIPYLGVYVFKYTIESFSAHISGFLVVDGIDKLAFESENINSEIHCDRVLTGD   1121 - 1190
ALLELNYGQEVWLRLAKGTIPAKFPPVTTFSGYLLYRT                                   1191 - 1228
//

Text Mined References (32)

PMID Year Title
26627825 2016 Extracellular Fibrinogen-binding Protein (Efb) from Staphylococcus aureus Inhibits the Formation of Platelet-Leukocyte Complexes.
26446635 2015 Circulating Anti-Elastin Antibody Levels and Arterial Disease Characteristics: Associations with Arterial Stiffness and Atherosclerosis.
25825478 2015 Multimerin-1 (MMRN1) as Novel Adverse Marker in Pediatric Acute Myeloid Leukemia: A Report from the Children's Oncology Group.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
21058943 2011 Replication of GWAS associations for GAK and MAPT in Parkinson's disease.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
19175495 2009 Platelet adhesion to multimerin 1 in vitro: influences of platelet membrane receptors, von Willebrand factor and shear.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
More...