Property Summary

NCBI Gene PubMed Count 66
Grant Count 166
R01 Count 84
Funding $17,005,219.96
PubMed Score 35.79
PubTator Score 10.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.300 0.000
non-small cell lung cancer 1.284 0.000
lung cancer 1.300 0.008
inflammatory breast cancer 1.300 0.004
ovarian cancer 2.200 0.000

Synonym

Accession Q13200 B4DX07 B4DXY1 E7EW34 E9PCS3 Q12932 Q15321 Q53XQ4 Q96I12
Symbols S2
P97
RPN1
TRAP2

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR   5L4K  

 GO Function (1)

Gene RIF (41)

PMID Text
23667555 the high-resolution solution structure of the UBL domain of human UBLCP1 and its interaction with Rpn1
23166591 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21465578 Results suggest that PSMD2 may be a good molecular target candidate.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20614012 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19881955 the 26S proteasome may provide a general predictive biomarker for radiotherapy outcome.
More...

AA Sequence

MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLVERLGEKDTSL      1 - 70
YRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERECL     71 - 140
KYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQREPLLTLVKEIVPYNMAHNAEHEACDLLME    141 - 210
IEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVED    211 - 280
IFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYK    281 - 350
THLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLW    351 - 420
DVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYA    421 - 490
GSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPL    491 - 560
GLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKD    561 - 630
KKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVS    631 - 700
NPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTH    701 - 770
LGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPL    771 - 840
PVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYDL      841 - 908
//

Text Mined References (78)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23667555 2013 Solution structure and Rpn1 interaction of the UBL domain of human RNA polymerase II C-terminal domain phosphatase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22901813 2012 Cancer vulnerabilities unveiled by genomic loss.
21465578 2011 Proteasomal non-catalytic subunit PSMD2 as a potential therapeutic target in association with various clinicopathologic features in lung adenocarcinomas.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...