Property Summary

NCBI Gene PubMed Count 93
Grant Count 118
R01 Count 68
Funding $18,223,083.61
PubMed Score 6.58
PubTator Score 113.68

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13191 A8K9S7 B7WNM4 Q13192 Q13193 Q3LIC0 Q63Z43 Q8IVC5
Symbols Cbl-b
RNF56
Nbla00127

Gene

PANTHER Protein Class (1)

PDB

2J6F   3ZNI   3PFV   2BZ8   2AK5   2DO6   2JNH   2LDR   2OOA   2OOB   3VGO  

 GWAS Trait (1)

Gene RIF (51)

PMID Text
26874193 direct interaction between Cblin and the TKB domain of Cbl-b
26353930 H19 non coding RNA-derived miR-675 enhances tumorigenesis and metastasis of breast cancer cells by downregulating c-Cbl and Cbl-b.
26112603 results show that Cbl-b suppresses human ORMDL3 expression through STAT6
26087197 Results suggest that Cbl-b improves the prognosis of RANK-expressing breast cancer patients by inhibiting RANKL-induced breast cancer cell migration and metastasis.
25921289 findings suggest that Cbl-b limits NGF-TrkA signaling to control the length of neurites.
25788263 Translocation of Cbl-b from the nucleus to the cytoplasm prevented the localization of P-gp to caveolae resulting in the reversal of multidrug resistance through the ubiquitination and degradation of c-Src.
25701378 Our results suggest that celecoxib-mediated upregulation of Cbl-b is responsible, at least in part, for the additive antitumor effect of celecoxib and rapamycin via inhibition of rapamycin-induced Akt activation.
25691332 Low CBLB expression is associated with glioma cell invasion.
25261476 The data suggest a role of the CBLB rs12487066 variant in the interactions of a genetic risk factor and IFN function during viral infections in multiple sclerosis.
24885194 Ubiquitin ligase Cbl-b represses IGF-I-induced epithelial mesenchymal transition via ZEB2 and microRNA-200c regulation in gastric cancer cells.
More...

AA Sequence

MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPKLQLKNS      1 - 70
PPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDR     71 - 140
RNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGDKTIVPWKVFRQCLHEVHQISSG    141 - 210
LEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKP    211 - 280
GSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPH    281 - 350
DHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP    351 - 420
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTSPGSSPLAQRR    421 - 490
KPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQDKPLPAPPPPLRDPPPPPPE    491 - 560
RPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHS    561 - 630
RVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRD    631 - 700
PVEEDDDEYKIPSSHPVSLNSQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFD    701 - 770
SASDPVPLPPARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG    771 - 840
SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRP    841 - 910
RRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAFPPPVSPRL    911 - 980
NL                                                                        981 - 982
//

Text Mined References (101)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26874193 2016 Structural analysis of the TKB domain of ubiquitin ligase Cbl-b complexed with its small inhibitory peptide, Cblin.
26353930 2015 H19 non coding RNA-derived miR-675 enhances tumorigenesis and metastasis of breast cancer cells by downregulating c-Cbl and Cbl-b.
26112603 2015 E3 ubiquitin ligase Cbl-b suppresses human ORMDL3 expression through STAT6 mediation.
26087197 2015 The E3 ubiquitin ligase Cbl-b improves the prognosis of RANK positive breast cancer patients by inhibiting RANKL-induced cell migration and metastasis.
25921289 2015 Temporal proteomics of NGF-TrkA signaling identifies an inhibitory role for the E3 ligase Cbl-b in neuroblastoma cell differentiation.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25788263 2015 Cbl-b inhibits P-gp transporter function by preventing its translocation into caveolae in multiple drug-resistant gastric and breast cancers.
25701378 2015 Celecoxib sensitizes gastric cancer to rapamycin via inhibition of the Cbl-b-regulated PI3K/Akt pathway.
25691332 2015 Ionizing radiation-inducible miR-30e promotes glioma cell invasion through EGFR stabilization by directly targeting CBL-B.
More...