Property Summary

NCBI Gene PubMed Count 29
Grant Count 12
R01 Count 12
Funding $690,572.1
PubMed Score 74.66
PubTator Score 39.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Batten disease 15 3.428 1.7

Expression

Gene RIF (9)

PMID Text
25410859 Together, these data strongly suggest that syntaxin 5-mediated retrograde transport to the Golgi apparatus is a broadly conserved feature of adeno-associated virus trafficking.
23701949 Stx5 might play a role in modulating VLDL-R physiology by participating in an abrasively described or completely novel Golgi-bypass pathway.
21715015 serum anti-STX5 autoantibody, which was discovered by a proteomic approach, is a potential new serum marker for the diagnosis of endometriosis.
21242315 Depletion of syntaxin-5 complex components results in the accumulation of autophagosomes as a result of lysosomal dysfunction, leading to decreased degradation of autophagic substrates.
19536132 Study shows that the SM protein, Sly1, interacts directly with the conserved oligomeric Golgi (COG) tethering complex; Sly1-COG interaction is mediated by the Cog4 subunit, which also interacts with Syntaxin 5 through a different binding site.
18187620 Knockdown of syntaxin 5 (STX5) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18167358 depletion of GM130 by RNA interference slows the rate of ER to Golgi trafficking in vivo; interactions of GM130 with syntaxin 5 and Rab1 are regulated by mitotic phosphorylation
17389686 hypothesize that syntaxin 5 also has trafficking-independent functions
16081076 Syx5 is required for the maintenance of the Golgi structures but may not play a major role in the transport of vesicles carrying proteins between the ER and the Golgi compartment.

AA Sequence

MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAGSSSSDIAPLPPPVTLVPPPPDTMSCRDRTQEFLSACKS      1 - 70
LQTRQNGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIK     71 - 140
QDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQSKLASMSNDFKSVLEVRTENLKQQRSRREQ    141 - 210
FSRAPVSALPLAPNHLGGGAVVLGAESHASKDVAIDMMDSRTSQQLQLIDEQDSYIQSRADTMQNIESTI    211 - 280
VELGSIFQQLAHMVKEQEETIQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIF    281 - 350
VVFLA                                                                     351 - 355
//

Text Mined References (37)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25410859 2015 Syntaxin 5-dependent retrograde transport to the trans-Golgi network is required for adeno-associated virus transduction.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23701949 2013 Stx5 is a novel interactor of VLDL-R to affect its intracellular trafficking and processing.
21715015 2011 Identification of anti-syntaxin 5 autoantibody as a novel serum marker of endometriosis.
21269460 2011 Initial characterization of the human central proteome.
21242315 2011 Autophagic substrate clearance requires activity of the syntaxin-5 SNARE complex.
19536132 2009 Direct interaction between the COG complex and the SM protein, Sly1, is required for Golgi SNARE pairing.
More...