Property Summary

NCBI Gene PubMed Count 33
PubMed Score 75.44
PubTator Score 39.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Batten disease 13 3.337 1.7
Pancreatic agenesis 17 3.292 1.6

Expression

Gene RIF (10)

AA Sequence

MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAGSSSSDIAPLPPPVTLVPPPPDTMSCRDRTQEFLSACKS      1 - 70
LQTRQNGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIK     71 - 140
QDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQSKLASMSNDFKSVLEVRTENLKQQRSRREQ    141 - 210
FSRAPVSALPLAPNHLGGGAVVLGAESHASKDVAIDMMDSRTSQQLQLIDEQDSYIQSRADTMQNIESTI    211 - 280
VELGSIFQQLAHMVKEQEETIQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIF    281 - 350
VVFLA                                                                     351 - 355
//

Text Mined References (41)

PMID Year Title