Property Summary

NCBI Gene PubMed Count 59
Grant Count 8
Funding $114,851
PubMed Score 11.06
PubTator Score 55.36

Knowledge Summary

Patent (2,419)

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer 1.100 0.003
malignant mesothelioma 1.200 0.000
psoriasis -2.200 0.000
glioblastoma multiforme 1.200 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.048
active Crohn's disease 1.168 0.024
group 4 medulloblastoma -1.300 0.023
pancreatic carcinoma 1.100 0.003
subependymal giant cell astrocytoma 1.786 0.028
ovarian cancer 1.200 0.017
pituitary cancer -1.100 0.000

Synonym

Accession Q13188 A8K722 B3KYA7 Q15445 Q15801 Q96FM6
Symbols KRS1
MST2

Gene

PDB

4LGD   5BRM   3WWS   4HKD   4L0N   4LG4   4OH9   5DH3  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (31)

PMID Text
25814670 using an Mst2 mutation that disrupts homotypic dimerization, we showed that the monomeric Mst2-SARAH domain could form a stable complex of 1:1 stoichiometric ratio with WW45 refolded under acidic pH.
25367221 The MST1/2-SAV1 complex, a core component of the Hippo pathway, promotes ciliogenesis.
25035424 results reveal a novel role of Mst2 in stress-dependent cardiac hypertrophy and remodeling in the adult mouse and likely human heart
24992339 These results suggest that AIF downregulation is a common event in kidney tumor development. AIF loss may lead to decreased STK3 activity, defective apoptosis and malignant transformation
24881775 Hippo and Yap regulate cardiomyocyte death and regeneration.
24255178 Results indicate that changes in phosphorylation orchestrate interactions between kinases and phosphatases in Hippo (MST1/2 protein kinases) signaling, providing a putative mechanism for pathway regulation.
24180524 results of the present study revealed that, in addition to the phosphorylated YAP/TAZ, the Hippo pathway can suppress the Wnt/beta-catenin pathway directly through MST1/2
23972470 RASSF5 can act as an inhibitor or a potential positive regulator of Mst2, depending on whether it binds to Mst2 before or after activation-loop phosphorylation.
23459937 The ability of K-Ras to activate MST2 and MST2-dependent apoptosis is determined by the differential activation kinetics of mutant K-Ras and wild type K-Ras.
22590567 The identification of the c-Abl tyrosine kinase as a novel upstream activator of MST2 suggests that the conserved c-Abl-MST signaling cascade plays an important role in oxidative stress-induced neuronal cell death.
More...

AA Sequence

MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKE      1 - 70
ISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFM     71 - 140
RKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGIT    141 - 210
SIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKN    211 - 280
AKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTM    281 - 350
IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPM    351 - 420
SKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQN    421 - 490
F//

Text Mined References (70)

PMID Year Title
25814670 2015 Low pH-driven folding of WW45-SARAH domain leads to stabilization of the WW45-Mst2 complex.
25416956 2014 A proteome-scale map of the human interactome network.
25367221 2014 The MST1/2-SAV1 complex of the Hippo pathway promotes ciliogenesis.
25035424 2014 The mammalian Ste20-like kinase 2 (Mst2) modulates stress-induced cardiac hypertrophy.
24992339 2014 AIF downregulation and its interaction with STK3 in renal cell carcinoma.
24881775 2014 Harnessing Hippo in the heart: Hippo/Yap signaling and applications to heart regeneration and rejuvenation.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24180524 2014 Mammalian sterile 20-like kinase 1/2 inhibits the Wnt/?-catenin signalling pathway by directly binding casein kinase 1?.
23972470 2013 Structural basis for autoactivation of human Mst2 kinase and its regulation by RASSF5.
More...