Property Summary

NCBI Gene PubMed Count 72
PubMed Score 79.51
PubTator Score 67.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.01737132021441E-12
glioblastoma 5572 6.47313611912261E-9
medulloblastoma, large-cell 6234 1.11409175178694E-6
pediatric high grade glioma 2712 1.8836112789933E-6
atypical teratoid/rhabdoid tumor 1095 2.3415911138224E-6
lung adenocarcinoma 2714 5.15580655939466E-6
Multiple myeloma 1328 5.78545966621511E-6
acute quadriplegic myopathy 1157 8.09042884631879E-6
psoriasis 6685 5.21317762904738E-5
lung cancer 4473 5.3888145517426E-5
group 3 medulloblastoma 2254 2.26929081662578E-4
pilocytic astrocytoma 3086 2.36200014290923E-4
nasopharyngeal carcinoma 1056 3.01816232649819E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.89469109464472E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.1940195831968E-4
primary pancreatic ductal adenocarcinoma 1271 5.46664845591192E-4
pancreatic cancer 2300 7.56859354447261E-4
dermatomyositis 967 9.00092161392319E-4
diabetes mellitus 1663 0.00110705084915462
oligodendroglioma 2849 0.00250921183998932
primitive neuroectodermal tumor 3031 0.00251555413182486
active Crohn's disease 918 0.00254515675286151
Waldenstrons macroglobulinemia 765 0.00278998938178124
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00359252604009602
osteosarcoma 7933 0.00465713256930905
ependymoma 2514 0.0113844664778268
Rheumatoid Arthritis 1171 0.0123854204313005
gastric carcinoma 832 0.016226269437539
astrocytic glioma 2241 0.0172040000496767
esophageal adenocarcinoma 737 0.0250063609477354
Breast cancer 3099 0.0255954017202544
aldosterone-producing adenoma 664 0.0297039229352679
acute myeloid leukemia 785 0.0428211558800431
Disease Target Count Z-score Confidence
Cancer 2346 3.15 1.6

Expression

Synonym

Accession Q13185 Q96CD7 Q99409 Q9BVS3 Q9P0Z6
Symbols HECH
HP1-GAMMA
HP1Hs-gamma

Gene

PDB

3TZD   5T1I   3DM1   2L11   3KUP  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (33)

PMID Text
26680990 these data underscore the importance of IDRs 1, 2, and 3 in defining the structural and dynamic properties of HP1gamma, discoveries that have both mechanistic and potentially biomedical relevance.
26333808 this study identified miR-30a as a tumor-suppressive microRNA that targets HP1gamma in vitro and in vivo to specifically suppress the growth of colorectal cancer in mouse xenograft models.
26319017 In contrast to HP1alpha, HP1gamma could not recognize H3K9me3 in extended nucleosomes.
25634209 BARD1 interacts with H3K9me2 through HP1 and plays a critical role in retention of a BRCA1/BARD1 complex at the site of DNA damage.
24981246 our data suggested that HP1gamma plays an important role in promoting non-small cell lung cancer
24751108 CBX3 and CRABP2 expression was markedly increased in lung cancer tissues
23522301 compartmentalized and total HP1gamma protein expression is increased in PCa and that expression correlates with clinical outcomes better than Gleason score.
23313480 HP1gamma affects the spontaneous differentiation potential of P19 cells, and might play major roles in the decision of cell fates in pluripotent stem cells.
23287531 study finds that while HP1apha and beta stimulate homologous recombination and single-strand annealing, HP1gamma has an inhibitory role
23166591 Expression of HIV-1 Tat upregulates the abundance of chromobox homolog 3 (CBX3) in the nucleoli of Jurkat T-cells
More...

AA Sequence

MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCP      1 - 70
ELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLM     71 - 140
KWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ                               141 - 183
//

Text Mined References (87)

PMID Year Title
26680990 2016 Evidence supporting a critical contribution of intrinsically disordered regions to the biochemical behavior of full-length human HP1?.
26333808 2015 Heterochromatin protein HP1? promotes colorectal cancer progression and is regulated by miR-30a.
26319017 2015 Nucleosome compaction facilitates HP1? binding to methylated H3K9.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25634209 2015 Interaction of BARD1 and HP1 Is Required for BRCA1 Retention at Sites of DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24981246 2014 Overexpression of HP1? is associated with poor prognosis in non-small cell lung cancer cell through promoting cell survival.
24751108 2014 RNA sequencing identifies novel markers of non-small cell lung cancer.
More...