Property Summary

NCBI Gene PubMed Count 75
PubMed Score 90.48
PubTator Score 67.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (33)

Disease log2 FC p
active Crohn's disease 1.366 2.5e-03
acute myeloid leukemia 2.600 4.3e-02
acute quadriplegic myopathy 1.093 8.1e-06
adult high grade glioma 1.600 3.9e-04
aldosterone-producing adenoma 1.323 3.0e-02
astrocytic glioma 1.700 1.7e-02
Astrocytoma, Pilocytic 1.200 2.2e-04
atypical teratoid / rhabdoid tumor 1.300 1.7e-05
Breast cancer 2.500 2.6e-02
dermatomyositis 1.400 9.0e-04
diabetes mellitus -2.300 1.1e-03
ependymoma 1.300 1.1e-02
esophageal adenocarcinoma 1.500 2.5e-02
gastric carcinoma 1.300 1.6e-02
glioblastoma 1.200 4.2e-03
group 3 medulloblastoma 2.600 2.3e-04
intraductal papillary-mucinous adenoma (... 1.400 4.2e-04
intraductal papillary-mucinous carcinoma... 1.300 2.8e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.1e-02
lung adenocarcinoma 1.298 5.2e-06
lung cancer 1.200 1.7e-03
medulloblastoma, large-cell 2.300 1.1e-06
Multiple myeloma 1.928 5.8e-06
nasopharyngeal carcinoma 1.100 3.0e-04
oligodendroglioma 1.600 1.7e-02
osteosarcoma 2.045 4.7e-03
ovarian cancer -1.800 1.0e-12
pancreatic cancer 1.300 7.6e-04
primary pancreatic ductal adenocarcinoma 1.527 5.5e-04
primitive neuroectodermal tumor 2.100 2.5e-03
psoriasis 1.800 5.2e-05
Rheumatoid arthritis 1.900 1.2e-02
Waldenstrons macroglobulinemia 1.920 2.8e-03

Gene RIF (35)

AA Sequence

MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCP      1 - 70
ELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLM     71 - 140
KWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ                               141 - 183
//

Text Mined References (92)

PMID Year Title